DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and YIL165C

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_012101.1 Gene:YIL165C / 854641 SGDID:S000001427 Length:119 Species:Saccharomyces cerevisiae


Alignment Length:52 Identity:12/52 - (23%)
Similarity:29/52 - (55%) Gaps:2/52 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 GHSMVVNPWAKVQQSASEGEE-IVVADIDFSEVEQVRQQI-PVFGQRRLDLY 276
            |.|::::|:.::......|:| ::.|:|:...:.:.|..: ||....|.|::
Yeast    53 GGSVIIDPYGEIIAGPLLGQEGLLTAEINTDLIAEARFDLDPVGHYARGDVF 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 10/46 (22%)
YIL165CNP_012101.1 nitrilase <1..110 CDD:416265 12/52 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.