DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and NIT2

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_012409.1 Gene:NIT2 / 853316 SGDID:S000003662 Length:307 Species:Saccharomyces cerevisiae


Alignment Length:315 Identity:95/315 - (30%)
Similarity:158/315 - (50%) Gaps:52/315 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TSNIMRLALLQLKGSKDKVANVQNAVTKIEAAVKEHKPRLITLPEC------------FNAPYGT 56
            ||.:.|:|:.||..|.|...|::.....|..|::: |..::.|||.            :.|....
Yeast     2 TSKLKRVAVAQLCSSADLTKNLKVVKELISEAIQK-KADVVFLPEASDYLSQNPLHSRYLAQKSP 65

  Fly    57 KYFREYSETIPDGYTSQQLSNLARKHQVYI---VGGTIPE-----LGENDAIYNTCTVWSPTGDL 113
            |:.|:...:|.|         |.|.:...|   :|..:|.     |..||.:.|........|.:
Yeast    66 KFIRQLQSSITD---------LVRDNSRNIDVSIGVHLPPSEQDLLEGNDRVRNVLLYIDHEGKI 121

  Fly   114 VAKHRKMHLFDIDVKGGIRFKESETLSAGNDF-TIINVDGHKIGIGICYDIRFEEMARLYRNAGC 177
            :.:::|:||||:||..|...|||:::..|... .||.....|:|..|||||||.|.:...|:.|.
Yeast   122 LQEYQKLHLFDVDVPNGPILKESKSVQPGKAIPDIIESPLGKLGSAICYDIRFPEFSLKLRSMGA 186

  Fly   178 EMIIYPAAFNMTTGPLHWELLQRSRANDNQLFVV---------TTSP---------ARDTSAEYV 224
            |::.:|:||.:.||..|||||.|:||.|.|.:|:         .:.|         |.:.|:...
Yeast   187 EILCFPSAFTIKTGEAHWELLGRARAVDTQCYVLMPGQVGMHDLSDPEWEKQSHMSALEKSSRRE 251

  Fly   225 AYGHSMVVNPWAKV---QQSASEGEEIVVADIDFSEVEQVRQQIPVFGQRRLDLY 276
            ::|||||::||.|:   ...::.|.::::||:|...::::|.::|::.|||.||:
Yeast   252 SWGHSMVIDPWGKIIAHADPSTVGPQLILADLDRELLQEIRNKMPLWNQRRDDLF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 89/304 (29%)
NIT2NP_012409.1 nit 7..302 CDD:143596 89/304 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.