DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and AT4G08790

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_567340.1 Gene:AT4G08790 / 826449 AraportID:AT4G08790 Length:307 Species:Arabidopsis thaliana


Alignment Length:286 Identity:92/286 - (32%)
Similarity:151/286 - (52%) Gaps:18/286 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKTSN-IMRLALLQLKGSKDKVANVQNAVTKI-EAAVKEHKPRLITLPECFNAPYGTKYFREYS 63
            |:.|.| .:|:|..|:....|.:.|.......: |||:...|  ||..||.|:. .|.|......
plant    29 MATTVNKTVRVAAAQMTSVNDLMTNFATCSRLVQEAALAGAK--LICFPENFSF-VGDKEGESVK 90

  Fly    64 ETIP-DGYTSQQLSNLARKHQVYIVGGTIPELGENDAIYNTCTVWSPTGDLVAKHRKMHLFDIDV 127
            ...| ||...::..:|||...:::..|...|..::..:.||..|....|.:...::||||||:||
plant    91 IAEPLDGPVMERYCSLARDSNIWLSLGGFQERFDDTHLCNTHVVIDDAGMIRDTYQKMHLFDVDV 155

  Fly   128 KGGIRFKESETLSAGNDFTIINVDG--HKIGIGICYDIRFEEMARLYR-NAGCEMIIYPAAFNMT 189
            .||..:|||.....|.  .|::||.  .::|:.:|||:||.::.:..| ....::::.|:||...
plant   156 PGGSSYKESSFTVPGT--KIVSVDSPVGRLGLTVCYDLRFPKIYQQLRFEQKAQVLLVPSAFTKV 218

  Fly   190 TGPLHWELLQRSRANDNQLFVVTTSPARDTSAEYVAYGHSMVVNPW----AKVQQSASEGEEIVV 250
            ||..|||:|.|:||.:.|.:|:..:.|...:.:..:||.:::::||    .::....|.|  |||
plant   219 TGEAHWEILLRARAIETQCYVIAAAQAGKHNEKRESYGDTLIIDPWGTVVGRLPDRVSTG--IVV 281

  Fly   251 ADIDFSEVEQVRQQIPVFGQR-RLDL 275
            ||||||.::.||.::|:..|| .:||
plant   282 ADIDFSLIDSVRTKMPIDKQRVSIDL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 87/272 (32%)
AT4G08790NP_567340.1 PLN02798 27..306 CDD:215428 90/283 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154369at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.