DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and NLP1

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_850101.1 Gene:NLP1 / 817290 AraportID:AT2G27450 Length:326 Species:Arabidopsis thaliana


Alignment Length:267 Identity:68/267 - (25%)
Similarity:110/267 - (41%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AAVKEHKPR---LITLPECFNAPYGTKYFRE--YSETIP--DGYTSQQLSNLARKHQVYIVGGTI 91
            |.|:|...:   :|.:.|.|...|..:..||  :....|  :..|..::..||::..|.|.....
plant    59 ALVREAHAKGANIILIQELFEGYYFCQAQREDFFKRAKPYKNHPTIARMQKLAKELGVVIPVSFF 123

  Fly    92 PELGENDAIYNTCTVWSPTGDLVAKHRKMHLFDIDVKGGIRFKESETLSAGN-DFTIINVDGHKI 155
            .|  .|.|.||:..:....|..:..:||.|:.|     |..::|....:.|: .|.:......||
plant   124 EE--ANTAHYNSIAIIDADGTDLGIYRKSHIPD-----GPGYQEKFYFNPGDTGFKVFQTKFAKI 181

  Fly   156 GIGICYDIRFEEMARLYRNAGCEMIIYPAAFNMTTGPL--------HWELLQRSRANDNQLFVVT 212
            |:.||:|..|.|.||.....|.|::.||.|..  :.|.        ||..:.:..|..|.:.:|.
plant   182 GVAICWDQWFPEAARAMVLQGAEILFYPTAIG--SEPQDQGLDSRDHWRRVMQGHAGANVVPLVA 244

  Fly   213 TS-------PARDTSAEYVAYGHSMVVNPWAKVQQSASE-GEEIVVADIDFSEVEQVRQQIPVFG 269
            ::       ......::...||.|.:..|..::...|.: .|.::||..|...::..||...||.
plant   245 SNRIGKEIIETEHGPSQITFYGTSFIAGPTGEIVAEADDKSEAVLVAQFDLDMIKSKRQSWGVFR 309

  Fly   270 QRRLDLY 276
            .||.|||
plant   310 DRRPDLY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 63/261 (24%)
NLP1NP_850101.1 PLN02747 4..326 CDD:215398 68/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001670
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.