DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and BTD

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001268652.2 Gene:BTD / 686 HGNCID:1122 Length:523 Species:Homo sapiens


Alignment Length:139 Identity:40/139 - (28%)
Similarity:65/139 - (46%) Gaps:34/139 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 QQLSNLARKHQVYIVG--GT----------IPELGENDAIYNTCTVWSPTGDLVAKHRKMHL--- 122
            |:||.:|.:..:::|.  ||          .|:.|...  :||..|:|..|.||.::||.:|   
Human   136 QRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQ--FNTNVVFSNNGTLVDRYRKHNLYFE 198

  Fly   123 --FDIDVKGGIRFKESETLSAGNDFTIINVDGHKIGIGICYDIRFEEMA-RLYRNAGCEMIIYPA 184
              ||:.:|  :.....:|..||           :.||..|:||.|.:.| |:.|:...:.::||.
Human   199 AAFDVPLK--VDLITFDTPFAG-----------RFGIFTCFDILFFDPAIRVLRDYKVKHVVYPT 250

  Fly   185 AFNMTTGPL 193
            |: |...||
Human   251 AW-MNQLPL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 40/139 (29%)
BTDNP_001268652.2 biotinidase_like 38..341 CDD:143591 40/139 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.