DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and BTD

DIOPT Version :10

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001268652.2 Gene:BTD / 686 HGNCID:1122 Length:523 Species:Homo sapiens


Alignment Length:139 Identity:40/139 - (28%)
Similarity:65/139 - (46%) Gaps:34/139 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 QQLSNLARKHQVYIVG--GT----------IPELGENDAIYNTCTVWSPTGDLVAKHRKMHL--- 122
            |:||.:|.:..:::|.  ||          .|:.|...  :||..|:|..|.||.::||.:|   
Human   136 QRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQ--FNTNVVFSNNGTLVDRYRKHNLYFE 198

  Fly   123 --FDIDVKGGIRFKESETLSAGNDFTIINVDGHKIGIGICYDIRFEEMA-RLYRNAGCEMIIYPA 184
              ||:.:|  :.....:|..||           :.||..|:||.|.:.| |:.|:...:.::||.
Human   199 AAFDVPLK--VDLITFDTPFAG-----------RFGIFTCFDILFFDPAIRVLRDYKVKHVVYPT 250

  Fly   185 AFNMTTGPL 193
            |: |...||
Human   251 AW-MNQLPL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 40/139 (29%)
BTDNP_001268652.2 biotinidase_like 38..341 CDD:143591 40/139 (29%)
Vanin_C 373..523 CDD:465946
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.