Sequence 1: | NP_649888.1 | Gene: | CG8132 / 41121 | FlyBaseID: | FBgn0037687 | Length: | 283 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001039309.1 | Gene: | btd / 555376 | ZFINID: | ZDB-GENE-060825-186 | Length: | 520 | Species: | Danio rerio |
Alignment Length: | 272 | Identity: | 67/272 - (24%) |
---|---|---|---|
Similarity: | 113/272 - (41%) | Gaps: | 58/272 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 RLALLQLKGSKDKVANVQNAVTKIEAAVKEHKPRLITLPECFNAPYGTKYFRE----YSETIPDG 69
Fly 70 Y-----------------TSQQLSNLARKHQVYIVGGTIPELGENDAI-----------YNTCTV 106
Fly 107 WSPTGDLVAKHRKMHLFDIDVKGGIRFKES-ETLSAGNDFTIINVDGHKIGIGICYDIRFEEMA- 169
Fly 170 RLYRNAGCEMIIYPAAFNMTTGPLHWEL-LQRSRANDNQLFVVTTSPARDTSAEYVAYGHSMVVN 233
Fly 234 PWAKVQQSASEG 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8132 | NP_649888.1 | nit | 9..272 | CDD:143596 | 67/272 (25%) |
btd | NP_001039309.1 | biotinidase_like | 33..335 | CDD:143591 | 67/272 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |