DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and vnn1

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_004914646.2 Gene:vnn1 / 496642 XenbaseID:XB-GENE-961108 Length:488 Species:Xenopus tropicalis


Alignment Length:209 Identity:52/209 - (24%)
Similarity:83/209 - (39%) Gaps:55/209 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IEAAVK---EHKPRLITLPECFNAPYGTKYFRE----YSETIPD----------------GYTSQ 73
            :|.|:|   .....:|..||  :..||..:.||    :.|.||.                .....
 Frog    58 LEKAIKSAASQGAHIIVTPE--DGIYGWIFTRETMYPFLENIPHPEVNWIPCSDPERFGRAPVQT 120

  Fly    74 QLSNLARKHQVYIVG----------GTI--PELGENDAIYNTCTVWSPTGDLVAKHRKMHLFDID 126
            :||.:|:.:.:|:|.          .|:  ||.|.  ..|||..|:...|.|||::.|.:||..:
 Frog   121 RLSCIAKLNSIYVVANIGDKKPCNISTVGCPEDGH--FYYNTAVVFDSDGRLVARYHKYNLFSFE 183

  Fly   127 VKGGIRFKESETLSAGNDFTIINVDGHKIGIGICYDIRF-EEMARLYRNAGCEMIIYPAAF---- 186
            .:..:. .|.|.::....|       .|.||.||:||.| :..|.|..:...:.|:||..:    
 Frog   184 GQFNVP-PEPEMVTFETPF-------GKFGIFICFDILFYKPAAALVVDHQVDTILYPTGWLNIL 240

  Fly   187 -NMTTGPLH--WEL 197
             :.|...:|  |.:
 Frog   241 PHFTAIEIHSAWAM 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 52/209 (25%)
vnn1XP_004914646.2 biotinidase_like 23..324 CDD:143591 52/209 (25%)
Vanin_C 337..485 CDD:408788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.