DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and NIT1

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_005245271.1 Gene:NIT1 / 4817 HGNCID:7828 Length:344 Species:Homo sapiens


Alignment Length:293 Identity:92/293 - (31%)
Similarity:147/293 - (50%) Gaps:32/293 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKTSNIMRLALLQLKGSKDKVANVQNAVTKIEAAVKEHKPRLITLPECF-------------NAP 53
            |.:..:..:|:.|:..:.||..|.:.....:..|.: ....|..|||.|             :.|
Human    58 SSSCELPLVAVCQVTSTPDKQQNFKTCAELVREAAR-LGACLAFLPEAFDFIARDPAETLHLSEP 121

  Fly    54 YGTKYFREYSETIPDGYTSQQLSNLARKHQVYIVGGTIPELGEN----DAIYNTCTVWSPTGDLV 114
            .|.|...||::             |||:..:::..|...|.|::    ..|||...:.:..|.:|
Human   122 LGGKLLEEYTQ-------------LARECGLWLSLGGFHERGQDWEQTQKIYNCHVLLNSKGAVV 173

  Fly   115 AKHRKMHLFDIDVKG-GIRFKESETLSAGNDFTIINVDGHKIGIGICYDIRFEEMARLYRNAGCE 178
            |.:||.||.|:::.| |...:.:.|:...:..:.::....|||:.:|||:||.|::.....||.|
Human   174 ATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDMRFPELSLALAQAGAE 238

  Fly   179 MIIYPAAFNMTTGPLHWELLQRSRANDNQLFVVTTSPARDTSAEYVAYGHSMVVNPWAKVQQSAS 243
            ::.||:||...|||.|||:|.|:||.:.|.:||..:.......:..:|||||||:||..|....|
Human   239 ILTYPSAFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGTVVARCS 303

  Fly   244 EGEEIVVADIDFSEVEQVRQQIPVFGQRRLDLY 276
            ||..:.:|.||.:.:.|:|:.:|||..||.|||
Human   304 EGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLY 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 86/280 (31%)
NIT1XP_005245271.1 nit 65..332 CDD:143596 86/280 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154369at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.