DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and pyd3

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_649732.1 Gene:pyd3 / 40916 FlyBaseID:FBgn0037513 Length:386 Species:Drosophila melanogaster


Alignment Length:303 Identity:65/303 - (21%)
Similarity:124/303 - (40%) Gaps:61/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KVANVQNAV----------------TKIEAAVK---EHKPRLITLPECFNAPYG----TKY-FRE 61
            :|..:||::                .|::..:|   |....::...|.:..|:.    .|: :.|
  Fly    74 RVGAIQNSIVIPTTAPIEKQREAIWNKVKTMIKAAAEAGCNIVCTQEAWTMPFAFCTREKFPWCE 138

  Fly    62 YSETIPDGYTSQQLSNLARKHQVYIVGGTIP-ELGENDAIYNTCTVWSPTGDLVAKHRKMHLFDI 125
            ::|...:|.|::.|:.||:.:.:.|:...:. ::...:.|:||..|.|.:|..:.||||.|:..:
  Fly   139 FAEEAENGPTTKMLAELAKAYNMVIIHSILERDMEHGETIWNTAVVISNSGRYLGKHRKNHIPRV 203

  Fly   126 DVKGGIRFKESETLSAGN-DFTIINVDGHKIGIGICYDIRFEEMARLYRNAGCEMIIYPAAFNMT 189
            .     .|.||.....|| ...:...:..|:.:.|||.....:...::...|.|::..|:|   |
  Fly   204 G-----DFNESTYYMEGNTGHPVFETEFGKLAVNICYGRHHPQNWMMFGLNGAEIVFNPSA---T 260

  Fly   190 TGPLH---WELLQRSRANDNQLFVV--------------TTSPARDTSAEY-VAYGHSMVVNPWA 236
            .|.|.   |.:..|:.|..|..|.|              |:........|: ..||.|.|..|..
  Fly   261 IGRLSEPLWSIEARNAAIANSYFTVPINRVGTEQFPNEYTSGDGNKAHKEFGPFYGSSYVAAPDG 325

  Fly   237 KVQQSASEGEE-IVVADIDFSEVEQVR--------QQIPVFGQ 270
            ....|.|..:: ::|.::|.:...||:        |::|::.:
  Fly   326 SRTPSLSRDKDGLLVVELDLNLCRQVKDFWGFRMTQRVPLYAE 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 65/303 (21%)
pyd3NP_649732.1 PLN00202 9..385 CDD:177792 65/303 (21%)
ML_beta-AS 9..372 CDD:143611 65/303 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466372
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.