DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and CG32750

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_727067.1 Gene:CG32750 / 326238 FlyBaseID:FBgn0052750 Length:523 Species:Drosophila melanogaster


Alignment Length:127 Identity:30/127 - (23%)
Similarity:56/127 - (44%) Gaps:20/127 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 QQLSNLARKHQVYIVGGTIPELGE---ND--------AIYNTCTVWSPTGDLVAKHRKMHLFDID 126
            :.|:..||::..|:|......:.|   :|        :|:||..|:...|.:::::||.:|: ::
  Fly   110 RSLACAAREYGTYLVVNVKERVSEQCTSDETCSSRGYSIHNTNVVFDRQGAVISRYRKWNLY-LE 173

  Fly   127 VKGGIRFKESETLSAGNDFTIINVDGHKIGIGICYDIRFEEMAR-LYRNAGCEMIIYPAAFN 187
            .... |.:..|..:...||.:      ..|..||:|:.|...|: |....|...:|....||
  Fly   174 PSTN-RTESPEIATFTTDFNV------TFGHFICFDMLFYTPAQDLVEQLGIRHVIVTKMFN 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 30/127 (24%)
CG32750NP_727067.1 biotinidase_like 29..322 CDD:143591 30/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.