DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and upb1

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_955910.1 Gene:upb1 / 322660 ZFINID:ZDB-GENE-030131-1380 Length:384 Species:Danio rerio


Alignment Length:327 Identity:77/327 - (23%)
Similarity:120/327 - (36%) Gaps:79/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IMRLALLQLKGSKDKVANVQNAVTKIEAAVKEHKP-------RLITLPECFNAPYG-----TKYF 59
            ::|:.|:|.|......|.|...:|.:...|.|...       .::...|.:..|:.     .:.:
Zfish    71 MVRVGLIQNKIVLPTDAPVLEQITALHKRVGEMVEVAAMCGVNIVCFQEAWTMPFAFCTREREPW 135

  Fly    60 REYSETIPDGYTSQQLSNLARKHQVYIV----------GGTIPELGENDAIYNTCTVWSPTGDLV 114
            .|::|:..||.|::....||:||.:.:|          |||         ::||..|.|..|:::
Zfish   136 TEFAESAEDGLTTRFCIQLAKKHNMVVVSPILERDEIHGGT---------LWNTAVVVSNNGNVL 191

  Fly   115 AKHRKMHLFDIDVKGGIRFKESETLSAGNDFTIINVDGH--------KIGIGICYDIRFEEMARL 171
            .|.||.|:..:.     .|.||.....||       .||        ||.:.|||.........:
Zfish   192 GKTRKNHIPRVG-----DFNESTYYMEGN-------TGHRVFQTQFGKIAVNICYGRHHPLNWLM 244

  Fly   172 YRNAGCEMIIYPAAFNMTTGPLH---WELLQRSRANDNQLFVVTTSPARDTSAEYVA-------- 225
            |...|.|:|..|:|   |.|.|.   |.:..|:.|..|..|   |........||..        
Zfish   245 YSVNGAEIIFNPSA---TVGLLSEPMWPIEARNAAIANHCF---TCAINRVGTEYFKNEFTSGDG 303

  Fly   226 ----------YGHSMVVNPWAKVQQSASEGEE-IVVADIDFSEVEQVRQQIPVFGQRRLDLYATE 279
                      ||.|.:..|........|...: ::||::|.:...||..:.......|.::||.|
Zfish   304 KKAHHDFGHFYGSSYMAAPDGSRTPGLSRTRDGLLVAELDLNLNRQVADKWNFKMTGRYEMYAEE 368

  Fly   280 RK 281
            .|
Zfish   369 LK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 72/314 (23%)
upb1NP_955910.1 PLN00202 6..384 CDD:177792 77/327 (24%)
ML_beta-AS 9..371 CDD:143611 77/327 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.