DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and Btnd

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_572298.1 Gene:Btnd / 31552 FlyBaseID:FBgn0029848 Length:553 Species:Drosophila melanogaster


Alignment Length:305 Identity:71/305 - (23%)
Similarity:114/305 - (37%) Gaps:88/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AAVKEH------KPR---------------------LITLPE-CFNAPYGTKYFREYSETIPDGY 70
            |||.||      .||                     :|..|| ..|:.....:....|:.|...|
  Fly    31 AAVVEHSQPVGDSPRARTTSASESFQKIIREVGDVDIIVFPEHILNSQATATFVPHESQNITPCY 95

  Fly    71 TSQ------QLSNLARKHQVYIVGGTI-PEL---GENDAIYNTC-----------TVWSPTGDLV 114
            .:.      :||..||.:.:|:|...: .||   |.....||.|           .|:...|.:|
  Fly    96 QTDYELFLIELSCSARANHLYVVINVVEKELCAHGAGSDTYNPCPSSGVRYFNTNVVFDRRGRIV 160

  Fly   115 AKHRKMHLFDIDVKGGIRFKESETLSAGNDFTIINVD-GHKIGIGICYDIRFEEMA-RLYRNAGC 177
            :::||.||:..:.       .|.::....|.:|...| |...|..||:|:.|.:.| :|.:....
  Fly   161 SRYRKTHLWRHEY-------VSTSVLRSPDISIFRTDFGVTFGHFICFDMLFYDPAMKLVKEHKI 218

  Fly   178 EMIIYPAAFNMTTGPLHW--EL-------LQRSRA--ND-NQLFVVTTSPARDTSAE--YVAYGH 228
            ..|:||.         :|  ||       ||...|  || |.|....::|...||..  |...|.
  Fly   219 TDIVYPT---------YWFSELPFLGAVQLQEGWAFGNDVNVLAADASNPDGRTSGSGIYAGRGG 274

  Fly   229 SMVVNPWAKVQQSASEGEEIVVADIDFSEVEQVRQQI-PVFGQRR 272
            .:|    |::.:..:  .::::|::...|..|:.... |:|..:|
  Fly   275 RLV----AEIFEQPT--TKLLIAEVPKREHGQLAPTFTPIFEPQR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 70/303 (23%)
BtndNP_572298.1 biotinidase_like 29..308 CDD:143591 68/298 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.