DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and vanin-like

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster


Alignment Length:321 Identity:75/321 - (23%)
Similarity:112/321 - (34%) Gaps:100/321 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALLQLKGSKDKVANVQNAVTKIEAAVKEHKPRLITLPE---------------------CFNAPY 54
            ::|.|....|.:|.....:....|:..:    :|..||                     |.:.|.
  Fly    43 SILSLSAWSDSLAGYVEIINSENASATD----IIVFPESTLNSAGSTTFVPNPEDQINPCLSDPN 103

  Fly    55 GTKYFREYSETIPDGYTSQQLSNLARKHQVYIVGG--------TIPE-------LGENDAIYNTC 104
            .| |:.|:..|         ||..||....|||..        .|||       .|.|  ::||.
  Fly   104 AT-YYEEFLVT---------LSCAARNASKYIVINLTEKQKCEDIPEDTRPCASNGLN--VFNTN 156

  Fly   105 TVWSPTGDLVAKHRKMHLFDIDVKGGIRFKESETLSAGNDFTIINVDGHKIGIGICYDIRFEEMA 169
            .|:...|.:|:::||:||:. :.|......|..|..  .||      |...|..||:||.|...|
  Fly   157 VVFDRQGVVVSRYRKVHLYG-EAKNSTFLPELITFE--TDF------GVTFGHFICFDILFYTPA 212

  Fly   170 -RLYRNAGCEMIIYPA----------AFNMTTGPLHWELLQRSRAND-NQLFVVTTSPARDTSAE 222
             :|....|....:|||          |.....|   |     :.||| |.|....:.|:...|..
  Fly   213 HQLIVEQGITDFVYPAMWFSQLPFLTAVQTQQG---W-----AYANDVNLLASGASRPSIGNSGS 269

  Fly   223 YVAYGHSMVVNPWAKVQQSASEGEEIVVADIDFSEVEQVRQQIPVFGQRRLDLYATERKAK 283
            .:.:|.|..:   ..|.:..|....|.||            |:|.:.:.|    :.:::||
  Fly   270 GIYHGRSGTL---TSVMRQDSGERAIYVA------------QVPKYTRSR----SLKKRAK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 72/308 (23%)
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 72/308 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.