DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and Vnn1

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001020794.1 Gene:Vnn1 / 29142 RGDID:1310075 Length:512 Species:Rattus norvegicus


Alignment Length:215 Identity:55/215 - (25%)
Similarity:91/215 - (42%) Gaps:51/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RLALLQLKGSKDKVANVQNAVTKIEAAV---KEHKPRLITLPECFNAPYGTKYFRE----YSETI 66
            ::.||.:..| :.:|.:...:..:|.|:   .:....:|..||  :..||.::.|:    |.|.|
  Rat    40 KVTLLPVSHS-EALALMNQNLDLLEGAILSAAKQGAHIIVTPE--DGIYGVQFTRDTIYPYLEDI 101

  Fly    67 PD--------------GYT--SQQLSNLARKHQVYIVG--GTIPELGENDA--------IYNTCT 105
            ||              |.|  .::||.||:.:.:|:|.  |.......:|:        .|||..
  Rat   102 PDPQVNWIPCDNPERFGSTPVQERLSCLAKNNSIYVVANMGDKKPCNTSDSHCPPDGRFQYNTDV 166

  Fly   106 VWSPTGDLVAKHRKMHLFDIDVKGGIRFK---ESETLSAGNDFTIINVDGHKIGIGICYDIRFEE 167
            |:...|.|||::.|.:||    .|..:|.   |.|.::....|       .|.||..|:||.|.:
  Rat   167 VFDSRGKLVARYHKQNLF----MGEEQFNAPPEPEVVTFDTPF-------GKFGIFTCFDILFHD 220

  Fly   168 MA-RLYRNAGCEMIIYPAAF 186
            .| .|......:.|::|.|:
  Rat   221 PAVTLVTEFQVDTILFPTAW 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 55/215 (26%)
Vnn1NP_001020794.1 biotinidase_like 27..324 CDD:143591 55/215 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.