DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and Nit1

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_872609.2 Gene:Nit1 / 289222 RGDID:727821 Length:327 Species:Rattus norvegicus


Alignment Length:290 Identity:98/290 - (33%)
Similarity:152/290 - (52%) Gaps:21/290 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKTS-NIMRLALLQLKGSKDKVANVQNAVTKIEAAVKEHKPRLITLPECFNAPYGTKYFREYSET 65
            |.|| .:..:|:.|:..:.:|..|.:.....::.|.: ....|..|||.|:.     ..|..:||
  Rat    41 SSTSWELPLVAVCQVTSTPNKQENFKTCAELVQEATR-LGACLAFLPEAFDF-----IARNPAET 99

  Fly    66 I----P-DGYTSQQLSNLARKHQVYIVGGTIPELGEN----DAIYNTCTVWSPTGDLVAKHRKMH 121
            :    | ||....|.|.|||:..:::..|...|.|::    ..|||...:.:..|.:||.:||.|
  Rat   100 LLLSEPLDGDLLGQYSQLARECGIWLSLGGFHERGQDWEQTQKIYNCHVLLNSKGSVVASYRKTH 164

  Fly   122 LFDIDVKGGIRFKESETLSAGNDFTI---INVDGHKIGIGICYDIRFEEMARLYRNAGCEMIIYP 183
            |.|:::.|....:||.....|  :.:   :.....|:|:.||||:||.|::.....||.|::.||
  Rat   165 LCDVEIPGQGPMRESNYTMPG--YALEPPVKTPAGKVGLAICYDMRFPELSLKLAQAGAEILTYP 227

  Fly   184 AAFNMTTGPLHWELLQRSRANDNQLFVVTTSPARDTSAEYVAYGHSMVVNPWAKVQQSASEGEEI 248
            :||...|||.|||:|.|:||.::|.:|:..:..........:|||||||:||..|..|.|||..:
  Rat   228 SAFGSVTGPAHWEVLLRARAIESQCYVIAAAQCGRHHETRASYGHSMVVDPWGTVVASCSEGPGL 292

  Fly   249 VVADIDFSEVEQVRQQIPVFGQRRLDLYAT 278
            .:|.||...::|:||.:|||..||.|||.:
  Rat   293 CLARIDLHFLQQMRQHLPVFQHRRPDLYGS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 90/274 (33%)
Nit1NP_872609.2 nit 49..316 CDD:143596 90/274 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154369at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.