DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and Vnn1

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_035834.2 Gene:Vnn1 / 22361 MGIID:108395 Length:512 Species:Mus musculus


Alignment Length:186 Identity:48/186 - (25%)
Similarity:79/186 - (42%) Gaps:42/186 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IEAAVKEHKPRLITLPECFNAPYGTKYFRE----YSETIPD--------------GYT--SQQLS 76
            |.:|.|: ...:|..||  :..||.::.|:    |.|.|||              |.|  .::||
Mouse    66 IVSAAKQ-GAHIIVTPE--DGIYGVRFTRDTIYPYLEEIPDPQVNWIPCDNPKRFGSTPVQERLS 127

  Fly    77 NLARKHQVYIVG--GTIPELGENDA--------IYNTCTVWSPTGDLVAKHRKMHLFDIDVKGGI 131
            .||:.:.:|:|.  |.......:|:        .|||..|:...|.|||::.|.::|    .|..
Mouse   128 CLAKNNSIYVVANMGDKKPCNTSDSHCPPDGRFQYNTDVVFDSQGKLVARYHKQNIF----MGED 188

  Fly   132 RFKESETLSAGNDFTIINVDGHKIGIGICYDIRFEEMA-RLYRNAGCEMIIYPAAF 186
            :|    .:....:|...:....|.|:..|:||.|.:.| .|......:.|::|.|:
Mouse   189 QF----NVPMEPEFVTFDTPFGKFGVFTCFDILFHDPAVTLVTEFQVDTILFPTAW 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 48/186 (26%)
Vnn1NP_035834.2 biotinidase_like 27..324 CDD:143591 48/186 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.