DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and nft-1

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_499556.1 Gene:nft-1 / 176628 WormBaseID:WBGene00003594 Length:440 Species:Caenorhabditis elegans


Alignment Length:284 Identity:98/284 - (34%)
Similarity:147/284 - (51%) Gaps:32/284 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALLQLKGSKDKVANVQNAVTKIEAAVKEHKPRLITLPECFN-------------APYGTKYFRE 61
            :|:.|:....|...|.|.|...||.| .|.|..::.|||||:             .....:|..:
 Worm    17 IAVCQMTSDNDLEKNFQAAKNMIERA-GEKKCEMVFLPECFDFIGLNKNEQIDLAMATDCEYMEK 80

  Fly    62 YSETIPDGYTSQQLSNLARKHQVYIVGGTIPELGENDAI--YNTCTVWSPTGDLVAKHRKMHLFD 124
            |.|             |||||.:::..|.:.....:||.  :||..:....|...|::.|:||||
 Worm    81 YRE-------------LARKHNIWLSLGGLHHKDPSDAAHPWNTHLIIDSDGVTRAEYNKLHLFD 132

  Fly   125 IDVKGGIRFKESETLSAGNDFTIINVDG--HKIGIGICYDIRFEEMARLYRNAGCEMIIYPAAFN 187
            :::.|.:|..|||...||.:. |..||.  .::|:.||||:||.|::...|..|.:::.:|:||.
 Worm   133 LEIPGKVRLMESEFSKAGTEM-IPPVDTPIGRLGLSICYDVRFPELSLWNRKRGAQLLSFPSAFT 196

  Fly   188 MTTGPLHWELLQRSRANDNQLFVVTTSPARDTSAEYVAYGHSMVVNPWAKVQQSASEGEEIVVAD 252
            :.||..|||.|.|:||.:||.:||..:.....:.:..:|||||||:||..|....||..::..|:
 Worm   197 LNTGLAHWETLLRARAIENQCYVVAAAQTGAHNPKRQSYGHSMVVDPWGAVVAQCSERVDMCFAE 261

  Fly   253 IDFSEVEQVRQQIPVFGQRRLDLY 276
            ||.|.|:.:|:..|||..||.|||
 Worm   262 IDLSYVDTLREMQPVFSHRRSDLY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 93/278 (33%)
nft-1NP_499556.1 nit 17..281 CDD:143596 93/278 (33%)
FHIT 300..418 CDD:238606
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.993157 Normalized mean entropy S629
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154369at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.