DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and upb-1

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_495261.1 Gene:upb-1 / 174040 WormBaseID:WBGene00017440 Length:387 Species:Caenorhabditis elegans


Alignment Length:323 Identity:86/323 - (26%)
Similarity:137/323 - (42%) Gaps:69/323 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKTSNIMRLALLQLK---GSKDKVANVQNAV-----TKIEAAVKEHKPRLITLPECFNAPYG--T 56
            ::...::|:|.:|.|   .:.|.|...::|:     ..||||... ...:|.|.|.:..|:.  |
 Worm    68 TRAPRLVRVAAIQNKIHRPTTDSVVEQRDAIHQRVGAMIEAAASA-GANVIGLQEAWTMPFAFCT 131

  Fly    57 KY---FREYSETIPDGYTSQQLSNLARKHQVYIVGGTIPELGE-NDAIYNTCTVWSPTGDLVAKH 117
            :.   :.|::|::..|.|:|.||.||.||.:.|:...:....| :|.|:||..|.|.||.::.:.
 Worm   132 RERLPWTEFAESVYTGPTTQFLSKLAVKHDIVIISPILERDEEKDDVIWNTAVVISHTGRVIGRS 196

  Fly   118 RKMHLFDI-DVKGGIRFKESETLSAGNDFTIINVDGH--------KIGIGICYDIRFEEMARLYR 173
            ||.|:..: |......:.|| ||            ||        :|||.|||.....:...:|.
 Worm   197 RKNHIPRVGDFNESTYYMES-TL------------GHPVFETKYGRIGINICYGRHHPQNWMMYA 248

  Fly   174 NAGCEMIIYPAAFNMTTGPLH---WELLQRSRANDNQLFVV-----------------TTSPARD 218
            ..|.|:|..|:|   |.|.|.   |.:..|:.|..|.:|.|                 ...||..
 Worm   249 LNGAEIIFNPSA---TVGALSEPLWGIEARNAAIANHVFTVGINRVGTEVFPNEFTSGNGQPAHK 310

  Fly   219 TSAEYVAYGHSMVVNPWAKVQQSASEGEE-IVVADIDFSEVEQVRQQIPVFGQR---RLDLYA 277
            ....:  ||.|.:..|......:.|...| :::|::|.:...|.:.   .:|.|   |||:||
 Worm   311 DFGHF--YGSSYIAAPDGSRTPALSRVREGVLIAELDLNLCRQCKD---AWGFRMTNRLDMYA 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 81/309 (26%)
upb-1NP_495261.1 ML_beta-AS 11..373 CDD:143611 86/323 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.