DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL34b and Rpl34

DIOPT Version :10

Sequence 1:NP_649887.1 Gene:RpL34b / 41120 FlyBaseID:FBgn0037686 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_081000.1 Gene:Rpl34 / 68436 MGIID:1915686 Length:117 Species:Mus musculus


Alignment Length:113 Identity:66/113 - (58%)
Similarity:79/113 - (69%) Gaps:3/113 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPR--CGQCKEKLKGITPSRPSERP 63
            ||||||.||||||||.|||.|:.||||.|:||.|.||....|:  ||.|..:|:|:...||....
Mouse     1 MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLM 65

  Fly    64 RMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKI-VKALKSQREA 110
            |:||..|.|||.|||.:|..|:|:||.|||||||||| ||.||:|.::
Mouse    66 RLSKTQKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQS 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL34bNP_649887.1 Ribosomal_L34e 1..94 CDD:426119 53/94 (56%)
Rpl34NP_081000.1 Ribosomal_L34e 1..96 CDD:426119 53/94 (56%)

Return to query results.
Submit another query.