DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85f and Or98b

DIOPT Version :9

Sequence 1:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:376 Identity:70/376 - (18%)
Similarity:136/376 - (36%) Gaps:114/376 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EDFARLPTTVFWIMGYDMLGVPKTRSRRILYWIYRFLC----LASH---GVCVGVMVFRMVEAKT 66
            :.|.||.:.:|.::|.::|.......|    :.:|.:|    :||.   .:..|:...:.||..|
  Fly     4 DKFLRLQSALFRLLGLELLHEQDVGHR----YPWRSICCILSVASFMPLTIAFGLQNVQNVEQLT 64

  Fly    67 IDNVSLIMRYATL------------VTYIINSDTKFATVLQRSAIQSLNSKLAELYPKTTLDRIY 119
            ....|:::....|            ..::|.   :|..|||...    ::.:||:.......|  
  Fly    65 DSLCSVLVDLLALCKIGLFLWLYKDFKFLIG---QFYCVLQTET----HTAVAEMIVTRESRR-- 120

  Fly   120 HRVNDHYWTKSFVYLVIIYIGSSIMVVIGPIITSIIAYFTHNVFTYMHCYPYFLYDPEKDPVWIY 184
                |.:.:..:.|   .:|.:.:...:...::.:|:|....               |..|.:.:
  Fly   121 ----DQFISAMYAY---CFITAGLSACLMSPLSMLISYQRTG---------------ELQPKFPF 163

  Fly   185 ISIYALEWLHSTQMVIS---NIGADIWL---------LYFQVQINL------------HFRGIIR 225
            .|:|..:.:..:..:||   |:.|.:.:         |:..:..||            ||.|  |
  Fly   164 PSVYPWDNMKLSNYIISYFWNVCAALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEG--R 226

  Fly   226 SLADHKPSVKH---------------DQEDRKFIAKIVDKQVHLVSLQNDLN-GIFGKSLLLSLL 274
            :..:...::||               ::..|..|.:.|...:||..|...|: .|...:||....
  Fly   227 NTKETHENLKHVFQLYALCLNLGHFLNEYFRPLICQFVAASLHLCVLCYQLSANILQPALLFYAA 291

  Fly   275 TTAAVICTVAVYTLIQGPTLEGFTYVIFIGTSVMQVYLVC-YYGQQVLDLS 324
            .||||:..|::|              .|.|:|   ::..| .:||.:.:.|
  Fly   292 FTAAVVGQVSIY--------------CFCGSS---IHSECQLFGQAIYESS 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 55/310 (18%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 58/317 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.