DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85f and Or85b

DIOPT Version :9

Sequence 1:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:372 Identity:96/372 - (25%)
Similarity:167/372 - (44%) Gaps:53/372 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MVFRMVEAKTIDNVSLIMRYATLVTYIINSDTKF---ATVL------------------QRSAIQ 100
            ::|.:|....:.|:|.:..:.::..|....|.||   .|.|                  :::||.
  Fly    31 LIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAIT 95

  Fly   101 SLNSKLAELYPKTTLDRIYHRVNDHYWTKSFVYLVIIYIGS-SIMVVIGPIITSIIAYFTHNVFT 164
            .|.::|.|:||...:             :...|.:.:|:|: |.:.:|..::.|::.: |.|:|.
  Fly    96 ELINELKEIYPNGLI-------------REERYNLPMYLGTCSRISLIYSLLYSVLIW-TFNLFC 146

  Fly   165 YMHCY---------------PYFLYDPEK-DPVWIYISIYALEWLHSTQMVISNIGADIWLLYFQ 213
            .|..:               ||.:|.|.| ...|.|..:...:...........|..|:.|....
  Fly   147 VMEYWVYDKWLNIRVVGKQLPYLMYIPWKWQDNWSYYPLLFSQNFAGYTSAAGQISTDVLLCAVA 211

  Fly   214 VQINLHFRGIIRSLADHKPSVKHDQEDRKFIAKIVDKQVHLVSLQNDLNGIFGKSLLLSLLTTAA 278
            .|:.:||..:..|:..|:.|... ::|.:|:..||.....::.|.:.:|.|||..|||:.:.::.
  Fly   212 TQLVMHFDFLSNSMERHELSGDW-KKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSF 275

  Fly   279 VICTVAVYTLIQGPTLEGFTYVIFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYNHDFHDASIAY 343
            |||.|.....:..|........:|:.:|:.||||:|:|||.|.|.|...:.|.||..::.|.:.|
  Fly   276 VICFVGFQMTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRY 340

  Fly   344 KRYLLIIIIRAQQPVELNAMGYLSISLDTFKQLMSVSYRVITMLMQM 390
            ||.|:|||.|:|:...|.|..:|.|:..|...|:.:||:...:|..|
  Fly   341 KRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLRTM 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 90/350 (26%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 85/328 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472785
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.