DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85f and Or85a

DIOPT Version :9

Sequence 1:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster


Alignment Length:428 Identity:77/428 - (17%)
Similarity:169/428 - (39%) Gaps:86/428 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EPVQYSYEDFARLPTTVFWIMGYDMLG---VPKTRSRRILYWIYRFLCLASHGVCVGVMVFRMVE 63
            |||..|.  |....:.::.....|.:|   .|:|:....||:|:..:.:        |:||..:.
  Fly     8 EPVLGSL--FRSRDSLIYLNRSIDQMGWRLPPRTKPYWWLYYIWTLVVI--------VLVFIFIP 62

  Fly    64 AKTI-DNVSLIMRYAT--LVTYI---INSDTKFATVLQ--------------RSAIQSLNSKLAE 108
            ...| ..:.....:.|  |.||:   :|::   |::::              :..:.:::.:..:
  Fly    63 YGLIMTGIKEFKNFTTTDLFTYVQVPVNTN---ASIMKGIIVLFMRRRFSRAQKMMDAMDIRCTK 124

  Fly   109 LYPKTTLDR----------IYHRVNDHYWTKSFVYLVIIYIGSSIMVVIGPIITSIIAYFTHNVF 163
            :..|..:.|          |||               .||.|...|.:.|.::....        
  Fly   125 MEEKVQVHRAAALCNRVVVIYH---------------CIYFGYLSMALTGALVIGKT-------- 166

  Fly   164 TYMHCYPYFLYDPEKDPVWIYISIYALEWLHSTQMVISNIGADIWLLYFQVQINLHFRGIIRSLA 228
                  |:.||:|..:|...:....|:|.:....::::|:..|::.:.:.|.:.:|...:...:.
  Fly   167 ------PFCLYNPLVNPDDHFYLATAIESVTMAGIILANLILDVYPIIYVVVLRIHMELLSERIK 225

  Fly   229 DHKPSVK--HDQEDRKFIAKIVDKQVHLVSLQNDLNGIFGKSLLLSLLTTAAVICTVAV----YT 287
            ..:..|:  .||...:.:..:.|.:: :|...|.|..:...::.:.||:...::...||    |.
  Fly   226 TLRTDVEKGDDQHYAELVECVKDHKL-IVEYGNTLRPMISATMFIQLLSVGLLLGLAAVSMQFYN 289

  Fly   288 LIQGPTLEGFTYVIFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYNHDFHDASIAYKRYLLIIII 352
            .:....:.| .|.|.|   :.|.:..||..:|:......:.:.:::..:..|...|:..:|..|.
  Fly   290 TVMERVVSG-VYTIAI---LSQTFPFCYVCEQLSSDCESLTNTLFHSKWIGAERRYRTTMLYFIH 350

  Fly   353 RAQQPVELNAMGYLSISLDTFKQLMSVSYRVITMLMQM 390
            ..||.:...|.|...|.|:|..::...::.|:|::.:|
  Fly   351 NVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTIVNEM 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 58/347 (17%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 58/338 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465981
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.