DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85f and Orco

DIOPT Version :9

Sequence 1:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:473 Identity:90/473 - (19%)
Similarity:171/473 - (36%) Gaps:189/473 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VSLIMRYA-TLVTYIINSD-------------------TKF--ATVLQRSAIQSLNSKLAELYPK 112
            |.|:|::. .||...:|::                   |||  ..|.|::..::||         
  Fly    51 VFLLMQFTFILVNMALNAEEVNELSGNTITTLFFTHCITKFIYLAVNQKNFYRTLN--------- 106

  Fly   113 TTLDRIYHRVNDH---------YWT------KSFVYLV-------------IIYIGSSIMVVIGP 149
                 |:::||.|         |.:      :...:||             |.:.|.|:.:|:..
  Fly   107 -----IWNQVNTHPLFAESDARYHSIALAKMRKLFFLVMLTTVASATAWTTITFFGDSVKMVVDH 166

  Fly   150 IITSII----------AYF----THNVFTYMHCYPYFLYDPEKDPVWIYISIYALEWLHSTQMVI 200
            ...|.|          :::    :|.:| ||..:.:.:|             |.|     ..|:.
  Fly   167 ETNSSIPVEIPRLPIKSFYPWNASHGMF-YMISFAFQIY-------------YVL-----FSMIH 212

  Fly   201 SNIGADI----WLLYFQVQINLHFRGIIRSL----------------------ADHKPSVKHDQE 239
            ||: .|:    ||::...|:. |.:||::.|                      |:.|..:.|::|
  Fly   213 SNL-CDVMFCSWLIFACEQLQ-HLKGIMKPLMELSASLDTYRPNSAALFRSLSANSKSELIHNEE 275

  Fly   240 D----------------------------------------------------------RKFIAK 246
            .                                                          |..|..
  Fly   276 KDPGTDMDMSGIYSSKADWGAQFRAPSTLQSFGGNGGGGNGLVNGANPNGLTKKQEMMVRSAIKY 340

  Fly   247 IVDKQVHLVSLQNDLNGIFGKSLLLSLLTTAAVICTVAVY--TLIQGPTLEGFTYVIFIGTSVMQ 309
            .|::..|:|.|...:...:|.:|||.:| |:.:..|:..|  |.|.|..:..||.|.::|.::.|
  Fly   341 WVERHKHVVRLVAAIGDTYGAALLLHML-TSTIKLTLLAYQATKINGVNVYAFTVVGYLGYALAQ 404

  Fly   310 VYLVCYYGQQVLDLSGEVAHAVYNHDFHDASIAYKRYLLIIIIRAQQPVELNAMGYLSISLDTFK 374
            |:..|.:|.::::.|..|..|.|:..::|.|...|.::.|:..:.|:.:.::...:.::|||.|.
  Fly   405 VFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFA 469

  Fly   375 QLMSVSYRVITMLMQMIQ 392
            .::..   |:|..|.::|
  Fly   470 SVLGA---VVTYFMVLVQ 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 86/460 (19%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 80/437 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.