DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85f and Or56a

DIOPT Version :9

Sequence 1:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:468 Identity:78/468 - (16%)
Similarity:163/468 - (34%) Gaps:142/468 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YSYEDFARLPTT-----------VFWIMGYDMLGVPKTRSRRILYWIYRFLCLASHGVCVGVM-- 57
            :..:|....|||           .|...||   ...|.::|.:|..|...:..||..:...:|  
  Fly     2 FKVKDLLLSPTTFEDPIFGTHLRYFQWYGY---VASKDQNRPLLSLIRCTILTASIWLSCALMLA 63

  Fly    58 -VFRMVEAKTIDNVSLIMRYATLVTYIINSDTKFATVLQRSAIQSL----NSKLAELYPKTTLDR 117
             |||..|.......|    |||.|.|...|...|...:||..:.||    :|.:..|..:.....
  Fly    64 RVFRGYENLNDGATS----YATAVQYFAVSIAMFNAYVQRDKVISLLRVAHSDIQNLMHEADNRE 124

  Fly   118 IYHRVNDHYWTKSFVYLVIIYIGSSIMVVIGPIITSIIAYFTHNVFTYMHCYPYFLYDP------ 176
            :...|....:|::...|:              .|.|:||    .:..|..|....|:.|      
  Fly   125 MELLVATQAYTRTITLLI--------------WIPSVIA----GLMAYSDCIYRSLFLPKSVFNV 171

  Fly   177 ------EKDPVWIY------------------------ISIYALEWLH----------------- 194
                  |:.|:.::                        :.|.|:...|                 
  Fly   172 PAVRRGEEHPILLFQLFPFGELCDNFVVGYLGPWYALGLGITAIPLWHTFITCLMKYVNLKLQIL 236

  Fly   195 ------------STQMVISNIGADIWLLYFQVQINLHFRGIIRSLADHKPSVKHDQEDRKFIAKI 247
                        ::::||..:.|. .|.::|:|:             .|..||.....|||:   
  Fly   237 NKRVEEMDITRLNSKLVIGRLTAS-ELTFWQMQL-------------FKEFVKEQLRIRKFV--- 284

  Fly   248 VDKQVHLVSLQNDLNGIFGKSLLLSLLTTAAVICTVAVYTLIQGPTLEGFTYV---IFIGTSVMQ 309
                       .:|..:....::...:..:.:||.:.....:..|:...:.::   :|:...::.
  Fly   285 -----------QELQYLICVPVMADFIIFSVLICFLFFALTVGVPSKMDYFFMFIYLFVMAGILW 338

  Fly   310 VYLVCYYGQQVLDLSGEVAHAVYNHDFHDASIAYKRYLLIIIIRAQQPVELNAMGYLSISLDTFK 374
            :|  .::...:::...|::.|.::..:::..:..::.|:.:::.||:|:::.|: .:.::|.||.
  Fly   339 IY--HWHATLIVECHDELSLAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMRAL-LVDLNLRTFI 400

  Fly   375 QLMSVSYRVITML 387
            .:...:|....:|
  Fly   401 DIGRGAYSYFNLL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 58/384 (15%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 44/329 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.