DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85f and Or33c

DIOPT Version :9

Sequence 1:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:333 Identity:67/333 - (20%)
Similarity:128/333 - (38%) Gaps:88/333 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 IQSLNSKLAELYPKTTLDRIYHRVNDHYWTKSFVYLVIIYIGSSIMVVIGPIITSIIAYFTHNVF 163
            |:||..:| :.:..:..:..|:|.:.|...:.|...:.|..|            .|.|.|...||
  Fly    94 IESLIEQL-DTFIASEQEHRYYRDHVHCHARRFTRCLYISFG------------MIYALFLFGVF 145

  Fly   164 ------TYMHCYP-YFLYDPEKDPVWIYISIYALEWLHSTQMV--ISNIGAD------------- 206
                  .:...|| ||.:|.|.:.   ::...||.:...:.:|  ...:|.|             
  Fly   146 VQVISGNWELLYPAYFPFDLESNR---FLGAVALGYQVFSMLVEGFQGLGNDTYTPLTLCLLAGH 207

  Fly   207 --IW------LLYFQVQINLHFRGIIRSLADHKPSVK-HDQEDRKFIAKIVDKQVHLVSLQNDLN 262
              :|      |.||..:..::.:.::..:..||..|: |:...|..      .:|.||.|..   
  Fly   208 VHLWSIRMGQLGYFDDETVVNHQRLLDYIEQHKLLVRFHNLVSRTI------SEVQLVQLGG--- 263

  Fly   263 GIFGKSLLLSLLTTAAVICTVAVYTL-IQGPTLEGFTYVIFIGTSVMQVYLVCYYGQQVLDLSGE 326
                         ..|.:|.:..|.| ..|.|:....|::|.|...:|::..||:..:|.:....
  Fly   264 -------------CGATLCIIVSYMLFFVGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELER 315

  Fly   327 VAHAVYNHDFHDASIAYKRYLLII----------IIRAQQPVELNAMGYLSISLDTFKQLMSVSY 381
            :.:|:::..::|.|..::..|||.          ||:|...:|||        |:.|...:.::|
  Fly   316 LPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELN--------LNAFFATLKMAY 372

  Fly   382 RVITMLMQ 389
            .:..::::
  Fly   373 SLFAVVVR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 66/323 (20%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 66/323 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.