DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85f and Or24a

DIOPT Version :9

Sequence 1:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:245 Identity:50/245 - (20%)
Similarity:107/245 - (43%) Gaps:40/245 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 KDPVWIY--------------ISIYALEWL----HSTQMVISNIGADIWLLYFQVQINLHFRGII 224
            ||  |||              :.:|.:.::    |....|:..:|||.:.|.|    .|:|..::
  Fly   163 KD--WIYETPFKMMFPDLLLRLPLYPITYILVHWHGYITVVCFVGADGFFLGF----CLYFTVLL 221

  Fly   225 RSLAD------------HKPSVKHDQEDRKFIAKIVDKQVHLVSLQNDLNGIFGKSLLLSLLTTA 277
            ..|.|            ..||...:....:.:.|:||:...:..|...|:|:..:..|...:|::
  Fly   222 LCLQDDVCDLLEVENIEKSPSEAEEARIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSS 286

  Fly   278 AVICTVAV-YTLIQGPTLEGFTYVIFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYNHDFHDASI 341
            .:|.|..| ..|..|  |....||::.....::::|.|..|..:::....:|.:.::..::..|:
  Fly   287 LIIGTSVVDILLFSG--LGIIVYVVYTCAVGVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSV 349

  Fly   342 AYKRYLLIIIIRAQQPVELNAMGYLSISLDTFKQLMSVSYRVITMLMQMI 391
            ..::..|:::.|||:.:.:. :.:.|.||:|...::..:..:|.:...:|
  Fly   350 RVQKMTLLMVARAQRVLTIK-IPFFSPSLETLTSILRFTGSLIALAKSVI 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 48/233 (21%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 48/233 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.