DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85f and Or22c

DIOPT Version :9

Sequence 1:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster


Alignment Length:184 Identity:48/184 - (26%)
Similarity:94/184 - (51%) Gaps:7/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LYFQVQINLHFRGIIRSLAD-HKPSV-----KHDQEDRKFIAKIVDKQVHLVSLQNDLNGIFGKS 268
            ||......|..:.|.|..|| |..||     :.:.|.|..:|::|::...::....||...|...
  Fly   216 LYICGAFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRHRLAQVVERHNAIIDFCTDLTRQFTVI 280

  Fly   269 LLLSLLTTAAVICTVAVYTLIQGPTLEGFTYVIFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYN 333
            :|:..|:.|.|:|:..:..::...:|.|.||:.:|..::.|::|.|:.|..|.:.|..||..:|:
  Fly   281 VLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLYD 345

  Fly   334 HDFHDASIAYKRYLLIIIIRAQQPVELNAMGYLSISLDTFKQLMSVSYRVITML 387
            .:::... |..|.::::|:|..|..:..|:.:.:.||...:.::|.:...||:|
  Fly   346 MEWYKCD-ARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILSTAGSYITLL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 45/176 (26%)
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 45/176 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465312
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.