DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85f and Or10a

DIOPT Version :9

Sequence 1:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:423 Identity:79/423 - (18%)
Similarity:158/423 - (37%) Gaps:84/423 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FARLPTTVFWIMGYDMLGVPKTRSRRILYWIYR----FLCLASHGVCVGVMVFRMVEAKTIDNVS 71
            |..:|.....||||   ...||...    |.:|    |..||     :||..........:|...
  Fly    18 FFAVPRLSLDIMGY---WPGKTGDT----WPWRSLIHFAILA-----IGVATELHAGMCFLDRQQ 70

  Fly    72 LIMRYATLVTYIINSDTKFATVLQRSAIQSLNSKLAELY--------------PKTTLDRIYH-- 120
            :.:...||..    :.|...|:|:...:......|:.::              |:....|:.|  
  Fly    71 ITLALETLCP----AGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSA 131

  Fly   121 ---RVNDHYWTKSFVYLVIIYIGSSIMVVIGPIITSIIAYFTHNVFTYMHCYPYFLYDPEKDPVW 182
               |:|  :|..|..:.......      :.||:.::|.|..:....::...|:.:..|:   |.
  Fly   132 MAARIN--FWPLSAGFFTCTTYN------LKPILIAMILYLQNRYEDFVWFTPFNMTMPK---VL 185

  Fly   183 IYISIYALEWLHSTQMVISNI----GADIWLLYFQVQINLHF-------RGIIRSLADH---KPS 233
            :....:.|.::.........|    |.|.:...|...::..|       ..:.|...||   .|.
  Fly   186 LNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPV 250

  Fly   234 VKHDQEDRKFIAKIVDKQVHLVSLQN----DLNGIFGKS---LLLSLLTTAAVICTVAVYTLIQ- 290
            ..:          |:::::..|.:::    ||...|...   :.|:...:||::...::..|:. 
  Fly   251 QLY----------ILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTL 305

  Fly   291 -GPTLEGFTYVIFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYNHDFHDASIAYKRYLLIIIIRA 354
             ...|....||.:...::.|:.:.||.|..|.:.|..:..|:::..:.......:|.:.::|:|:
  Fly   306 GNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRS 370

  Fly   355 QQPVELNAMGYLSISLDTFKQLMSVSYRVITML 387
            |:||.: |:.:.|.||.||..::..|..:|.::
  Fly   371 QRPVSM-AVPFFSPSLATFAAILQTSGSIIALV 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 62/354 (18%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 61/351 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.