DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and RIPK1

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001341859.1 Gene:RIPK1 / 8737 HGNCID:10019 Length:671 Species:Homo sapiens


Alignment Length:277 Identity:75/277 - (27%)
Similarity:130/277 - (46%) Gaps:29/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 ELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNI 1121
            ::.:.|.:....:..|.||.|.....::..|.:.....:.....|.....|:|.:::.:..|..:
Human    11 KMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRLRHSRV 75

  Fly  1122 VKLIGICVQKQPIMIVMELVLGGSLLTYLR-KNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRD 1185
            |||:|:.:::....:|||.:..|:|:..|: :.|..|:.:.::.:  :...||.||..|..||:|
Human    76 VKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL--EIIEGMCYLHGKGVIHKD 138

  Fly  1186 LAARNCLVDLEHSVKISDFGM----------SREEEEYIVSDGMKQI---PVKWTAPEALN--FG 1235
            |...|.|||.:..:||:|.|:          :.|..|....||..:.   .:.:.|||.||  ..
Human   139 LKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNA 203

  Fly  1236 KYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARER----IDTGYRMPTPKST---PEEMYRLM 1293
            |.|...||:|:.:::|.||:..: ||.   |:...::    |.:|.|......|   |.|:..||
Human   204 KPTEKSDVYSFAVVLWAIFANKE-PYE---NAICEQQLIMCIKSGNRPDVDDITEYCPREIISLM 264

  Fly  1294 LQCWAADAESRPHFDEI 1310
            ..||.|:.|:||.|..|
Human   265 KLCWEANPEARPTFPGI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 74/271 (27%)
PTKc_Fes_like 1067..1315 CDD:270637 74/267 (28%)
RIPK1NP_001341859.1 STKc_RIP1 23..290 CDD:270929 74/265 (28%)
Interaction with SQSTM1. /evidence=ECO:0000269|PubMed:10356400 290..582
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..354
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..458
RIP homotypic interaction motif (RHIM). /evidence=ECO:0000269|PubMed:11734559, ECO:0000269|PubMed:29681455 531..547
Death_RIP1 583..668 CDD:260048
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.