Sequence 1: | NP_524288.3 | Gene: | FER / 41118 | FlyBaseID: | FBgn0000723 | Length: | 1325 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_015480.1 | Gene: | PIN3 / 856277 | SGDID: | S000006358 | Length: | 215 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 213 | Identity: | 41/213 - (19%) |
---|---|---|---|
Similarity: | 73/213 - (34%) | Gaps: | 60/213 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 569 AAVLTNTNNNHIYADLELDKKKDTSPSPECKGEQIQPKKEQIRIEINQT---------APQNSID 624
Fly 625 AHLDRIDELNRV---LDDRLKRTLQPSDDVNAIESAEENHIQTRKLAKD-------------PDS 673
Fly 674 QTKRSSSSSSECRSSKDTSHSKKRSLSFSQKSISNIFSNLKEFSKSPLVRMGKNHILNEEQDAKR 738
Fly 739 TQP------SQHHHSSGS 750 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FER | NP_524288.3 | F-BAR_Fes_Fer | 7..243 | CDD:153341 | |
SH2_Fps_family | 953..1039 | CDD:198224 | |||
TyrKc | 1063..1311 | CDD:197581 | |||
PTKc_Fes_like | 1067..1315 | CDD:270637 | |||
PIN3 | NP_015480.1 | SH3 | 58..110 | CDD:418401 | 11/63 (17%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000006 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |