DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and PIN3

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_015480.1 Gene:PIN3 / 856277 SGDID:S000006358 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:41/213 - (19%)
Similarity:73/213 - (34%) Gaps:60/213 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 AAVLTNTNNNHIYADLELDKKKDTSPSPECKGEQIQPKKEQIRIEINQT---------APQNSID 624
            :|.|.|.:..:|..:|:.           .||..:  ....:..:||::         ||:|:..
Yeast     2 SASLINRSLTNIRTELDF-----------LKGSNV--ISNDVYDQINKSLPAKWDPANAPRNASP 53

  Fly   625 AHLDRIDELNRV---LDDRLKRTLQPSDDVNAIESAEENHIQTRKLAKD-------------PDS 673
            |.|:.::.|.:.   .|..|  .|:|.|.|..:|          ||:.:             |.:
Yeast    54 ASLEYVEALYQFDPQQDGDL--GLKPGDKVQLLE----------KLSPEWYKGSCNGRTGIFPAN 106

  Fly   674 QTKRSSSSSSECRSSKDTSHSKKRSLSFSQKSISNIFSNLKEFSKSPLVRMGKNHILNEEQDAKR 738
            ..|.:.|.|:...:.......|.:.|    :.|....|....:.:.|......|:....:|..::
Yeast   107 YVKPAFSGSNGPSNLPPPPQYKAQEL----QQIPTQNSAASSYQQQPFPPPSTNYYQQPQQQPQQ 167

  Fly   739 TQP------SQHHHSSGS 750
            ..|      .|.|.||.|
Yeast   168 APPPQQQQQQQQHQSSHS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
PIN3NP_015480.1 SH3 58..110 CDD:418401 11/63 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.