DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AT1G70740

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001185366.1 Gene:AT1G70740 / 843411 AraportID:AT1G70740 Length:425 Species:Arabidopsis thaliana


Alignment Length:236 Identity:71/236 - (30%)
Similarity:119/236 - (50%) Gaps:25/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1068 RIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQ-KRKFLQEGRILKQYDHPNIVKLIGICVQK 1131
            ::|.|.||.|:|.:|...: |:|||  :::....| |.:|:.|.::|.:..|.|:|.|.|.|...
plant    55 KLGEGGFGPVFKGRLPDGR-DIAVK--KLSQVSRQGKNEFVNEAKLLAKVQHRNVVNLWGYCTHG 116

  Fly  1132 QPIMIVMELVLGGSLLTYLRKNS--NGLTTRQQMGMCRDAAAGMRYL--ESKNC-IHRDLAARNC 1191
            ...::|.|.|:..||...|.|::  :.:..:|:..:....|.|:.||  ::.|| ||||:.|.|.
plant   117 DDKLLVYEYVVNESLDKVLFKSNRKSEIDWKQRFEIITGIARGLLYLHEDAPNCIIHRDIKAGNI 181

  Fly  1192 LVDLEHSVKISDFGMSREEEEYIVSDGMKQIPVK-WTAPEALNFGKYTSLCDVWSYGILMWEIFS 1255
            |:|.:...||:||||:|..:|.:.....:..... :.|||.:..|..:...||:|:|:|:.|:  
plant   182 LLDEKWVPKIADFGMARLYQEDVTHVNTRVAGTNGYMAPEYVMHGVLSVKADVFSFGVLVLEL-- 244

  Fly  1256 KGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQC 1296
                 .||..||        .:.|..|..|..|..:.::.|
plant   245 -----VSGQKNS--------SFSMRHPDQTLLEWVKPLVSC 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 71/236 (30%)
PTKc_Fes_like 1067..1315 CDD:270637 71/236 (30%)
AT1G70740NP_001185366.1 STYKc 54..332 CDD:214568 71/236 (30%)
STKc_IRAK 56..328 CDD:270968 71/235 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.