DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and HT1

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_176430.2 Gene:HT1 / 842538 AraportID:AT1G62400 Length:390 Species:Arabidopsis thaliana


Alignment Length:271 Identity:85/271 - (31%)
Similarity:133/271 - (49%) Gaps:13/271 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1053 RERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKR-----KFLQEGRI 1112
            ||.|......:.:..:...|....:|:...|...  ||||..|:....|:.|     :|..|..:
plant    76 REEWTADLSQLFIGNKFASGAHSRIYRGIYKQRA--VAVKMVRIPTHKEETRAKLEQQFKSEVAL 138

  Fly  1113 LKQYDHPNIVKLIGICVQKQPI-MIVMELVLGGSLLTYL-RKNSNGLTTRQQMGMCRDAAAGMRY 1175
            |.:..|||||:.|..| :|.|: .|:.|.:..|:|..|| :|....|:....:.:..|.:.||.|
plant   139 LSRLFHPNIVQFIAAC-KKPPVYCIITEYMSQGNLRMYLNKKEPYSLSIETVLRLALDISRGMEY 202

  Fly  1176 LESKNCIHRDLAARNCLVDLEHSVKISDFGMSREEEEYIVSDGMKQIPVKWTAPEALNFGKYTSL 1240
            |.|:..|||||.:.|.|::.|..||::|||.|..|.:...:.| .....:|.|||.:....||..
plant   203 LHSQGVIHRDLKSNNLLLNDEMRVKVADFGTSCLETQCREAKG-NMGTYRWMAPEMIKEKPYTRK 266

  Fly  1241 CDVWSYGILMWEIFSKGDTPYSGMTNSRARERI-DTGYRMPTPKSTPEEMYRLMLQCWAADAESR 1304
            .||:|:||::||: :....|:.|||..:|...: :...|.|.|.|....:..|:.:||:.:...|
plant   267 VDVYSFGIVLWEL-TTALLPFQGMTPVQAAFAVAEKNERPPLPASCQPALAHLIKRCWSENPSKR 330

  Fly  1305 PHFDEIYNVVD 1315
            |.|..|..|::
plant   331 PDFSNIVAVLE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 80/255 (31%)
PTKc_Fes_like 1067..1315 CDD:270637 82/255 (32%)
HT1NP_176430.2 STKc_MAP3K-like 93..340 CDD:270901 81/251 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.