DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Src

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_114183.1 Gene:Src / 83805 RGDID:620795 Length:542 Species:Rattus norvegicus


Alignment Length:555 Identity:170/555 - (30%)
Similarity:256/555 - (46%) Gaps:122/555 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   836 RSKPCKQCTKRRRIHPSKSVFDFAKEFEVEQPAGSAADEQFCNCPPAGQKPVKPSVQISGHKD-- 898
            :|||.....:||.:.|:::|          ..||.|.        ||.|.|.||: ...||:.  
  Rat     5 KSKPKDASQRRRSLEPAENV----------HGAGGAF--------PASQTPSKPA-SADGHRGPN 50

  Fly   899 ---------HP-----FESS--------SGEL-------------DENSDRDID----------N 918
                     .|     |.||        :|.|             :..::.|:.          |
  Rat    51 AAFVPPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVN 115

  Fly   919 DEEEEDSASDD-----VLSMKDHCYCVPS--LAASISLSTNRPLYEEEWFHGVLPREEVVRLL-- 974
            :..:.|....|     .||.....| :||  :|.|.|:..      |||:.|.:.|.|..|||  
  Rat   116 NTRKVDVREGDWWLAHSLSTGQTGY-IPSNYVAPSDSIQA------EEWYFGKITRRESERLLLN 173

  Fly   975 --NNDGDFLVRE----------TIRNEESQIVLSVCWNGHKHFIVQTTGEGNFRFEG-PPFASIQ 1026
              |..|.|||||          ::.:.::...|:|     ||:.::....|.|.... ..|.|:|
  Rat   174 AENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV-----KHYKIRKLDSGGFYITSRTQFNSLQ 233

  Fly  1027 ELIMHQYHSE--------LPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAKLK 1083
            :|:  .|:|:        |.....:.....:.:.::.||:..:.:.|..::|:|.||:|:.....
  Rat   234 QLV--AYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWN 296

  Fly  1084 STKLDVAVKTCRM-TLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLL 1147
            .| ..||:||.:. |:..|   .||||.:::|:..|..:|:|..: |.::||.||.|.:..||||
  Rat   297 GT-TRVAIKTLKPGTMSPE---AFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMNKGSLL 356

  Fly  1148 TYLRKNSNG--LTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSR-- 1208
            .:| |...|  |...|.:.|....|:||.|:|..|.:||||.|.|.||......|::|||::|  
  Rat   357 DFL-KGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLI 420

  Fly  1209 EEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERI 1273
            |:.||....|.| .|:|||||||..:|::|...||||:|||:.|:.:||..||.||.|....:::
  Rat   421 EDNEYTARQGAK-FPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQV 484

  Fly  1274 DTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFD 1308
            :.|||||.|...||.::.||.|||..:.|.||.|:
  Rat   485 ERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFE 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 29/108 (27%)
TyrKc 1063..1311 CDD:197581 103/251 (41%)
PTKc_Fes_like 1067..1315 CDD:270637 102/247 (41%)
SrcNP_114183.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 18/62 (29%)
SH3_Src 88..149 CDD:212941 10/61 (16%)
SH2_Src_Src 153..253 CDD:198228 29/112 (26%)
PTKc_Src 266..542 CDD:270656 105/261 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.