DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AT5G66710

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_201472.1 Gene:AT5G66710 / 836804 AraportID:AT5G66710 Length:405 Species:Arabidopsis thaliana


Alignment Length:459 Identity:108/459 - (23%)
Similarity:182/459 - (39%) Gaps:156/459 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   881 PAGQKPVKPSVQISGHKDHPFESSSGELDENSDRDIDNDEEEEDSASDDVLSMKDHCYCVPSLAA 945
            |:.|||.......:.|.::||..||..|     :..::|:|::||.|                  
plant    10 PSMQKPTDYPTDKTLHPNYPFLMSSHGL-----KSFESDDEDDDSDS------------------ 51

  Fly   946 SISLSTNRPLYEEEWFHGVLPREEVVRLLNNDGDFLVRETIRNEESQIVLSVCWNGHKHFIVQTT 1010
                                         :||                                 
plant    52 -----------------------------SND--------------------------------- 54

  Fly  1011 GEGNFRFEGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFG 1075
               .|.|              ..::||.|.||                   |:.:.:.||.|:..
plant    55 ---QFAF--------------TINTELLVDVK-------------------DISIGDFIGEGSSS 83

  Fly  1076 DVYKAKLK-----STKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIM 1135
            .||:...:     |.|:....:|..:::  ||::||.:|..:|.::.|.|||:.||.|::.: :|
plant    84 TVYRGLFRRVVPVSVKIFQPKRTSALSI--EQRKKFQREVLLLSKFRHENIVRFIGACIEPK-LM 145

  Fly  1136 IVMELVLGGSLLTY-LRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLV--DLEH 1197
            |:.||:.|.:|..: |......|..:..:....|.|.||.:|.:...|||||...|.|:  |.:|
plant   146 IITELMEGNTLQKFMLSVRPKPLDLKLSISFALDIARGMEFLNANGIIHRDLKPSNMLLTGDQKH 210

  Fly  1198 SVKISDFGMSREEEEYIVSDGMKQIPVKWTAPE-----ALNFGK---YTSLCDVWSYGILMWEIF 1254
             ||::|||::|||.:..::  .:....:|.|||     .|..|:   |....||:|:.|:.||:.
plant   211 -VKLADFGLAREETKGFMT--FEAGTYRWMAPELFSYDTLEIGEKKHYDHKVDVYSFAIVFWELL 272

  Fly  1255 SKGDTPYSGMTNSRARERIDTGY-----RMPTPKSTPEEMYRLMLQCWAADAESRPHFDEI-YNV 1313
            : ..||:.|..|      |...|     :.|:.::.||.:..::..|||.:.::||.|.|| |::
plant   273 T-NKTPFKGKNN------IFVAYAASKNQRPSVENLPEGVVSILQSCWAENPDARPEFKEITYSL 330

  Fly  1314 VDAL 1317
            .:.|
plant   331 TNLL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 6/85 (7%)
TyrKc 1063..1311 CDD:197581 81/269 (30%)
PTKc_Fes_like 1067..1315 CDD:270637 82/269 (30%)
AT5G66710NP_201472.1 STYKc 71..326 CDD:214568 79/267 (30%)
STKc_MAP3K-like 77..330 CDD:270901 82/265 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.