DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AT5G50180

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_199829.1 Gene:AT5G50180 / 835083 AraportID:AT5G50180 Length:346 Species:Arabidopsis thaliana


Alignment Length:278 Identity:96/278 - (34%)
Similarity:142/278 - (51%) Gaps:27/278 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1055 RWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTC-RMTLPDE-QKR--KFLQEGRILKQ 1115
            :|::....:.:..:||.|....||:.|.|:.  .||:|.. |...|:| .||  :||:|..:|.:
plant    12 KWQIDPQLLFVGPKIGEGAHAKVYEGKYKNQ--TVAIKIVHRGETPEEIAKRDSRFLREVEMLSR 74

  Fly  1116 YDHPNIVKLIGICVQKQPIM-IVMELVLGGSLLTY-LRKNSNGLTTRQQMGMCRDAAAGMRYLES 1178
            ..|.|:||.||.|  |:|:| ||.||:.||:|..| |......|.||..:|...|.|.||..|.|
plant    75 VQHKNLVKFIGAC--KEPVMVIVTELLQGGTLRKYLLNLRPACLETRVAIGFALDIARGMECLHS 137

  Fly  1179 KNCIHRDLAARNCLVDLEH-SVKISDFGMSREE---EEYIVSDGMKQIPVKWTAPE-----ALNF 1234
            ...|||||...|.|:..:| :||::|||::|||   |......|    ..:|.|||     .|..
plant   138 HGIIHRDLKPENLLLTADHKTVKLADFGLAREESLTEMMTAETG----TYRWMAPELYSTVTLRL 198

  Fly  1235 GK---YTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQC 1296
            |:   |....|.:|:.|::||:. ....|:.||:|.:|..........|:.:|.|||:..::..|
plant   199 GEKKHYNHKVDAYSFAIVLWELL-HNKLPFEGMSNLQAAYAAAFKNVRPSAESLPEELGDIVTSC 262

  Fly  1297 WAADAESRPHFDEIYNVV 1314
            |..|..:||:|..|..::
plant   263 WNEDPNARPNFTHIIELL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 94/265 (35%)
PTKc_Fes_like 1067..1315 CDD:270637 95/266 (36%)
AT5G50180NP_199829.1 STKc_MAP3K-like 26..280 CDD:270901 95/262 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.