DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AT5G50000

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_199811.1 Gene:AT5G50000 / 835064 AraportID:AT5G50000 Length:385 Species:Arabidopsis thaliana


Alignment Length:311 Identity:93/311 - (29%)
Similarity:149/311 - (47%) Gaps:33/311 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1035 SELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLP 1099
            |..|||:..|..:.:...|..||:....:::...:.||.||.|::......  |||||.  :...
plant    54 SSSPVTLNGGGFVGKRKQRLEWEIDPSKLIIKTVLARGTFGTVHRGIYDGQ--DVAVKL--LDWG 114

  Fly  1100 DEQKRK----------FLQEGRILKQYDHPNIVKLIG---------ICVQKQPI-------MIVM 1138
            :|..|.          |.||..:..:.||||:.|.||         :..:..|:       .:|:
plant   115 EEGHRSEAEIVSLRADFAQEVAVWHKLDHPNVTKFIGATMGASGLQLQTESGPLAMPNNICCVVV 179

  Fly  1139 ELVLGGSLLTYLRKN-SNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKIS 1202
            |.:.||:|.:||.|| ...||.:..:.:..|.|.|:.||.|:..:|||:...|.|:|...:|||:
plant   180 EYLPGGALKSYLIKNRRRKLTFKIVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIA 244

  Fly  1203 DFGMSREEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNS 1267
            |||::|.|.........:...:.:.|||.||...|...|||:|:||.:|||:. .|.||..:|.|
plant   245 DFGVARVEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYC-CDMPYPDLTFS 308

  Fly  1268 RARER-IDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDAL 1317
            ..... :....|...|:..|..:..:|.:||.|:.:.||..||:..:::::
plant   309 EVTSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESI 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 1/3 (33%)
TyrKc 1063..1311 CDD:197581 85/275 (31%)
PTKc_Fes_like 1067..1315 CDD:270637 85/275 (31%)
AT5G50000NP_199811.1 STKc_MAP3K-like 88..356 CDD:270901 85/272 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.