DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AT5G47070

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_199518.1 Gene:AT5G47070 / 834753 AraportID:AT5G47070 Length:410 Species:Arabidopsis thaliana


Alignment Length:312 Identity:81/312 - (25%)
Similarity:133/312 - (42%) Gaps:60/312 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 ELSNDDVVLLER--IGRGNFGDVYKAKLKST------KLDVAVKTC-RMTLPDEQKRKFLQEGRI 1112
            |||....|...:  ||.|.||.|||.|:.|.      .|.||:|.. |..|  :..:::|.|.:.
plant    78 ELSKATYVFSRKLVIGEGGFGIVYKGKILSNGDSSDPPLVVAIKKLNRQGL--QGHKQWLAEVQF 140

  Fly  1113 LKQYDHPNIVKLIGICVQKQPI----MIVMELVLGGSLLTYL-RKNSNGLTTRQQMGMCRDAAAG 1172
            |...:|||:|||||.|.:....    ::|.|.:...||..:| .:.|:.|..::::.:...||.|
plant   141 LGVVNHPNVVKLIGYCSEDGETGIERLLVYEYMSNRSLEDHLFPRRSHTLPWKKRLEIMLGAAEG 205

  Fly  1173 MRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSREEEEYIVSDGMKQIPVK-----WTAPEAL 1232
            :.||.....|:||..:.|.|:|.:...|:||||::||..:   .|.......:     :.|||.:
plant   206 LTYLHDLKVIYRDFKSSNVLLDDQFCPKLSDFGLAREGPD---GDNTHVTTARVGTHGYAAPEYV 267

  Fly  1233 NFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARER------------------------- 1272
            ..|......||:|:|::::||          :|..|..||                         
plant   268 QTGHLRLKSDVYSFGVVLYEI----------ITGRRTIERNKPVAERRLLDWVKEYPADSQRFSM 322

  Fly  1273 -IDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDALILRLDN 1323
             :|...|...|.:....:.:|...|...:.:.||..:.:...:..:|...|:
plant   323 IVDPRLRNNYPAAGARSLAKLADLCLKKNDKERPTMEIVVERLKKIIEESDS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 76/292 (26%)
PTKc_Fes_like 1067..1315 CDD:270637 75/292 (26%)
AT5G47070NP_199518.1 STYKc 91..365 CDD:214568 75/288 (26%)
STKc_IRAK 92..368 CDD:270968 75/290 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.