DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AT5G01850

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001332324.1 Gene:AT5G01850 / 831760 AraportID:AT5G01850 Length:357 Species:Arabidopsis thaliana


Alignment Length:324 Identity:93/324 - (28%)
Similarity:147/324 - (45%) Gaps:74/324 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1058 LSNDDVV---------LL---ERIGRGNFGDVYKAKLKSTKLDVAVKTC-RMTLPDEQ---KRKF 1106
            :|:||.:         ||   .:||.|..|.||:.:.  .:..||:|.. |.:.||:|   :.:|
plant     1 MSSDDTIEESLLVDPKLLFIGSKIGEGAHGKVYQGRY--GRQIVAIKVVNRGSKPDQQSSLESRF 63

  Fly  1107 LQEGRILKQYDHPNIVKL------------------------IGICVQKQPIM-IVMELVLGGSL 1146
            ::|..::.:..|.|:||:                        ||.|  |.|:| ||.||:.|.||
plant    64 VREVNMMSRVQHHNLVKVSLLLSSLSLLSILLLEYTISIWQFIGAC--KDPLMVIVTELLPGMSL 126

  Fly  1147 LTYLRKNSNGLTTRQQ-------MGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEH-SVKISD 1203
            ..||      .:.|.|       :....|.|..:..|.:...|||||...|.|:...| |||::|
plant   127 RKYL------TSIRPQLLHLPLALSFALDIARALHCLHANGIIHRDLKPDNLLLTENHKSVKLAD 185

  Fly  1204 FGMSREEEEYIVSDGM--KQIPVKWTAPE-----ALNFGK---YTSLCDVWSYGILMWEIFSKGD 1258
            ||::|||.   |::.|  :....:|.|||     .|..|:   |.:..||:|:||::||:.: ..
plant   186 FGLAREES---VTEMMTAETGTYRWMAPELYSTVTLRQGEKKHYNNKVDVYSFGIVLWELLT-NR 246

  Fly  1259 TPYSGMTNSRARERIDTGYRMPT-PKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDALILRL 1321
            .|:.||:|.:|..........|. |:.....:..::..||..|...||.|.:|..:::..:|.|
plant   247 MPFEGMSNLQAAYAAAFKQERPVMPEGISPSLAFIVQSCWVEDPNMRPSFSQIIRLLNEFLLTL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 87/307 (28%)
PTKc_Fes_like 1067..1315 CDD:270637 86/295 (29%)
AT5G01850NP_001332324.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.