DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AT4G31170

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001031758.1 Gene:AT4G31170 / 829245 AraportID:AT4G31170 Length:412 Species:Arabidopsis thaliana


Alignment Length:272 Identity:89/272 - (32%)
Similarity:141/272 - (51%) Gaps:15/272 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1054 ERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQK-----RKFLQEGRIL 1113
            |.|.:....:.:.....:|.||.:|:......  |||:|....:..:.:|     ::|.||..:|
plant   122 EEWTIDLRKLHMGPAFAQGAFGKLYRGTYNGE--DVAIKLLERSDSNPEKAQALEQQFQQEVSML 184

  Fly  1114 KQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSN-GLTTRQQMGMCRDAAAGMRYLE 1177
            ....|||||:.||.|::.....||.|...|||:..:|.|..| .:..:..:....|.|.||.|:.
plant   185 AFLKHPNIVRFIGACIKPMVWCIVTEYAKGGSVRQFLTKRQNRAVPLKLAVMQALDVARGMAYVH 249

  Fly  1178 SKNCIHRDLAARNCLVDLEHSVKISDFGMSREEEEYIVSDGM--KQIPVKWTAPEALNFGKYTSL 1240
            .:|.|||||.:.|.|:..:.|:||:|||::|.|   :.::||  :....:|.|||.:....||..
plant   250 ERNFIHRDLKSDNLLISADRSIKIADFGVARIE---VQTEGMTPETGTYRWMAPEMIQHRPYTQK 311

  Fly  1241 CDVWSYGILMWEIFSKGDTPYSGMTNSRAR-ERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESR 1304
            .||:|:||::||:.: |..|:..||..:|. ..::.|.|...|......:..:|.:||.||.|.|
plant   312 VDVYSFGIVLWELIT-GLLPFQNMTAVQAAFAVVNRGVRPTVPADCLPVLGEIMTRCWDADPEVR 375

  Fly  1305 PHFDEIYNVVDA 1316
            |.|.||.|:::|
plant   376 PCFAEIVNLLEA 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 84/256 (33%)
PTKc_Fes_like 1067..1315 CDD:270637 86/256 (34%)
AT4G31170NP_001031758.1 STKc_MAP3K-like 138..385 CDD:270901 86/252 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.