DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AT4G14780

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_193214.1 Gene:AT4G14780 / 827133 AraportID:AT4G14780 Length:364 Species:Arabidopsis thaliana


Alignment Length:309 Identity:84/309 - (27%)
Similarity:140/309 - (45%) Gaps:59/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1050 PVCRERWELSNDDVVLLER---IGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDE---------- 1101
            |..:|.||:   |:..||.   |.||.:|.|||......  |||||.  :...|:          
plant    48 PKAKEEWEI---DLAKLETSNVIARGTYGTVYKGIYDGQ--DVAVKV--LDWEDDGNETTAKTAT 105

  Fly  1102 QKRKFLQEGRILKQYDHPNIVKLIGI----------------CVQKQPIMIVMELVLGGSLLTYL 1150
            .:..|.||..:..:.:|||:.|.:|.                .:.:|...:|:|.:.||:|..:|
plant   106 NRALFRQEVTVWHKLNHPNVTKFVGASMGTTNLNIRSADSKGSLPQQACCVVVEYLPGGTLKQHL 170

  Fly  1151 -RKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSREE---- 1210
             |..|..|..:..:.:..|.|.|:.||.|:..:|||:...|.|:|.:.::||:|||::|.|    
plant   171 IRHKSKKLAFKAVIKLALDLARGLSYLHSEKIVHRDVKTENMLLDAQKNLKIADFGVARVEALNP 235

  Fly  1211 EEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDT 1275
            ::.....|    .:.:.|||.::...|...|||:|:||.:|||:. .|.||..::      .:|.
plant   236 KDMTGETG----TLGYMAPEVIDGKPYNRRCDVYSFGICLWEIYC-CDMPYPDLS------FVDV 289

  Fly  1276 -------GYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDAL 1317
                   ..|...|:..|..:..:|..||..:.:.||...|:..:::.:
plant   290 SSAVVLHNLRPEIPRCCPTALAGIMKTCWDGNPQKRPEMKEVVKMLEGV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 79/288 (27%)
PTKc_Fes_like 1067..1315 CDD:270637 78/288 (27%)
AT4G14780NP_193214.1 STYKc 61..335 CDD:214568 79/288 (27%)
STKc_MAP3K-like 67..335 CDD:270901 77/282 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.