DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AT3G50730

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_190642.2 Gene:AT3G50730 / 824237 AraportID:AT3G50730 Length:371 Species:Arabidopsis thaliana


Alignment Length:283 Identity:92/283 - (32%)
Similarity:147/283 - (51%) Gaps:25/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1058 LSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVK----TCRMTLPDEQKRKFLQEGRILKQYDH 1118
            |..:|||:.|.||.|.:..|||..|:: :..||||    :....:....|:.|.:|..:|.:..|
plant    31 LDRNDVVVGEMIGEGAYSIVYKGLLRN-QFPVAVKIMDPSTTSAVTKAHKKTFQKEVLLLSKMKH 94

  Fly  1119 PNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIH 1183
            .||||.:|.|::.| ::||.|||.||:|..::......|..:..:....|.:..|.::.|...||
plant    95 DNIVKFVGACIEPQ-LIIVTELVEGGTLQRFMHSRPGPLDLKMSLSFALDISRAMEFVHSNGIIH 158

  Fly  1184 RDLAARNCLV--DLEHSVKISDFGMSREEEEYIVSDGM--KQIPVKWTAPEA------LNFG--- 1235
            |||..||.||  ||:| ||::|||::|||    ...||  :....||.|||.      |..|   
plant   159 RDLNPRNLLVTGDLKH-VKLADFGIAREE----TRGGMTCEAGTSKWMAPEVVYSPEPLRVGEKK 218

  Fly  1236 KYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAAD 1300
            :|....|::|:.|::|::.: .:.|:..:.||.....:.:..|.|....||:....::..|||.|
plant   219 EYDHKADIYSFAIVLWQLVT-NEEPFPDVPNSLFVPYLVSQGRRPILTKTPDVFVPIVESCWAQD 282

  Fly  1301 AESRPHFDEIYNVVDALILRLDN 1323
            .::||.|.||..::..|:.|:.:
plant   283 PDARPEFKEISVMLTNLLRRMSS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 87/264 (33%)
PTKc_Fes_like 1067..1315 CDD:270637 86/264 (33%)
AT3G50730NP_190642.2 TyrKc 36..292 CDD:197581 86/263 (33%)
STKc_MAP3K-like 42..296 CDD:270901 85/261 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.