DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AT3G46930

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001327397.1 Gene:AT3G46930 / 823846 AraportID:AT3G46930 Length:515 Species:Arabidopsis thaliana


Alignment Length:267 Identity:82/267 - (30%)
Similarity:132/267 - (49%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1067 ERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQ---------KRKFLQEGRILKQYDHPNIV 1122
            :|...|.:..:|..:.:...  ||:|.  :|.|::.         :::|:.|..:|.:..|||:|
plant   205 DRFAHGKYSQIYHGEYEGKA--VALKI--ITAPEDSDDIFLGARLEKEFIVEATLLSRLSHPNVV 265

  Fly  1123 KLIGI----CVQKQPIMIVMELVLGGSLLTYLRK-NSNGLTTRQQMGMCRDAAAGMRYLESKNCI 1182
            |.:|:    |       |:.|.|..|||.:||.| ....|...|.:....|.|.||.|:.|:..:
plant   266 KFVGVNTGNC-------IITEYVPRGSLRSYLHKLEQKSLPLEQLIDFGLDIAKGMEYIHSREIV 323

  Fly  1183 HRDLAARNCLVDLEHSVKISDFGMSREEEEY--IVSDGMKQIPVKWTAPEALNFGKYTSLCDVWS 1245
            |:||...|.|:|.:..:||:|||::. ||||  ::.|.:.  ..:|.|||.|....:...|||:|
plant   324 HQDLKPENVLIDNDFHLKIADFGIAC-EEEYCDVLGDNIG--TYRWMAPEVLKRIPHGRKCDVYS 385

  Fly  1246 YGILMWEIFSKGDTPYSGM--TNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFD 1308
            :|:|:||:.: |..||..|  ....|...|....|...|...|..|..|:.:||::..:.||.|.
plant   386 FGLLLWEMVA-GALPYEEMKFAEQIAYAVIYKKIRPVIPTDCPAAMKELIERCWSSQTDKRPEFW 449

  Fly  1309 EIYNVVD 1315
            :|..|::
plant   450 QIVKVLE 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 80/261 (31%)
PTKc_Fes_like 1067..1315 CDD:270637 82/265 (31%)
AT3G46930NP_001327397.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.