DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AT3G22750

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_566716.1 Gene:AT3G22750 / 821846 AraportID:AT3G22750 Length:378 Species:Arabidopsis thaliana


Alignment Length:310 Identity:86/310 - (27%)
Similarity:149/310 - (48%) Gaps:42/310 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1041 VKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVK----------TCR 1095
            |.|.:|.:.|..:|.||:....:.:...|.||.:|.|||......  |||||          |..
plant    52 VWSRSIEKHPKPKEEWEIELAKLEMRNVIARGAYGIVYKGIYDGQ--DVAVKVLDWGEDGYATTA 114

  Fly  1096 MTLPDEQKRKFLQEGRILKQYDHPNIVKLIGI-----------------CVQKQPIMIVMELVLG 1143
            .|  ...:..|.||..:..:.||||:.:.:|.                 .:.::...:|:|.:.|
plant   115 ET--SALRASFRQEVAVWHKLDHPNVTRFVGASMGTANLKIPSSAETENSLPQRACCVVVEYIPG 177

  Fly  1144 GSLLTYL-RKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMS 1207
            |:|..|| |.....|..:..:.:..|.:.|:.||.|:..:|||:...|.|:|.:.::||:|||::
plant   178 GTLKQYLFRNRRKKLAFKVVVQLALDLSRGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVA 242

  Fly  1208 REEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPY-----SGMTNS 1267
            |.|.:.......:...:.:.|||.|:...|...|||:|:||.:|||:. .|.||     :.::::
plant   243 RVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYC-CDMPYPDLSFADVSSA 306

  Fly  1268 RARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDAL 1317
            ..|:.:    |...|:..|..:..:|.:||.|:.|.||..:|:.::::|:
plant   307 VVRQNL----RPDIPRCCPTALATIMKRCWEANPEKRPEMEEVVSLLEAV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 78/280 (28%)
PTKc_Fes_like 1067..1315 CDD:270637 78/280 (28%)
AT3G22750NP_566716.1 Pkinase_Tyr 74..349 CDD:285015 78/283 (28%)
STKc_MAP3K-like 80..349 CDD:270901 78/277 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.