DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Musk

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_112323.2 Gene:Musk / 81725 RGDID:3211 Length:868 Species:Rattus norvegicus


Alignment Length:916 Identity:206/916 - (22%)
Similarity:338/916 - (36%) Gaps:261/916 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 GEQIQPKKEQIRIEINQTAPQNSIDAHLDRIDEL----------------NRVL----DDRLK-- 642
            |.:..||...|      |.|..::||.::.:...                |::|    |.|..  
  Rat    20 GTEKLPKAPVI------TTPLETVDALVEEVATFMCAVESYPQPEISWTRNKILIKLFDTRYSIR 78

  Fly   643 --------RTLQPSDD-----------VNAIESAEENHIQTRKLAKDPDSQTK--RSSSSSSECR 686
                    .:::.|||           ..|:||.....::.:.....|....|  ....:...| 
  Rat    79 ENGQLLTILSVEDSDDGIYCCTANNGVGGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPC- 142

  Fly   687 SSKDTSHSKKRSLSFSQKSISNIFSNLKEFSKSPLVRMGKNHILN-EEQDAKRTQ---------- 740
               .|..:.|.|:|:.:..     |.|:|.|:..::..|...|.| :::||.:.:          
  Rat   143 ---TTMGNPKPSVSWIKGD-----SALRENSRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTA 199

  Fly   741 ------------------PSQHHHSSGS---------DCPTNSSSSSSNNNNNNKNTSSNSNHSA 778
                              |..|:.:.||         ..|..:.|...|.|    ..||.|....
  Rat   200 YSKLVKLEVEVFARILRAPESHNVTFGSFVTLRCTAIGMPVPTISWIENGN----AVSSGSIQEN 260

  Fly   779 SQSTIITSTITTTIT-----TTTTTTPSKENSRLKFKVPKI------------QKKSKAIRNTFR 826
            .:..:|.|.:...||     |...|....|    ||...|.            ||:||.....:|
  Rat   261 VKDRVIDSRLQLFITKPGLYTCIATNKHGE----KFSTAKAAATVSIAEWSKSQKESKGYCAQYR 321

  Fly   827 SKLLNFQLKR--------SKPCKQCTKRRRIHPSKSVFDFAKEFEVEQP-AGSAADEQFCNCPPA 882
            .::.:..|.:        |.|..:..:...||.:.:      |.:...| ...||:...||    
  Rat   322 GEVCDAVLVKDSLVFFNTSYPDPEEAQELLIHTAWN------ELKAVSPLCRPAAEALLCN---- 376

  Fly   883 GQKPVKPSVQISGHKDHPF-ESSSGELDENSDRDIDND---EEEEDSASDDVLSM--KDH----- 936
                            |.| |.|||.|.  :...|..:   ..:|...:.:.|:|  |.|     
  Rat   377 ----------------HLFQECSSGVLP--TPMPICREYCLAVKELFCAKEWLAMEGKTHRGLYR 423

  Fly   937 ----------CYCVPSLAASISLSTNRPL--YEEE---WFHGVL---PREEVVRLLNNDGDFLVR 983
                      |..:||:....:..|..|.  |::|   .|..:.   |..::..|..:...|.|.
  Rat   424 SGMHFLPVPECSKLPSMHQDPTACTRLPYLDYKKENITTFPSITSSKPSVDIPNLPASTSSFAVS 488

  Fly   984 ETIRNEESQIVLSV-----------------C-----WNGHKH---FIVQTTGEGNFRFEGPPFA 1023
            ...   ...:::|:                 |     |...|.   .:..||             
  Rat   489 PAY---SMTVIISIMSCFAVFALLTITTLYCCRRRREWKNKKRESAAVTLTT------------- 537

  Fly  1024 SIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAKLKSTK-- 1086
            ...||::.:.|.. |:..:...:|...:....:..:|.:.|  ..||.|.||.|::|:.....  
  Rat   538 LPSELLLDRLHPN-PMYQRMPLLLNPKLLSLEYPRNNIEYV--RDIGEGAFGRVFQARAPGLLPY 599

  Fly  1087 ---LDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLT 1148
               ..||||..:.....:.:..|.:|..::.::|:||||||:|:|...:|:.::.|.:..|.|..
  Rat   600 EPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNE 664

  Fly  1149 YLRKNS---------NGLTTR--------------QQMGMCRDAAAGMRYLESKNCIHRDLAARN 1190
            :||..|         :.|:||              :|:.:.|..||||.||..:..:|||||.||
  Rat   665 FLRSMSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRN 729

  Fly  1191 CLVDLEHSVKISDFGMSRE--EEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEI 1253
            |||.....|||:|||:||.  ..:|..:||...||::|..||::.:.:||:..|||:||:::|||
  Rat   730 CLVGENMVVKIADFGLSRNIYSADYYKADGNDAIPIRWMPPESIFYNRYTTESDVWAYGVVLWEI 794

  Fly  1254 FSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDALI 1318
            ||.|..||.||.:......:..|..:..|::.|.|:|.||..||:.....||.|..|:.::..:.
  Rat   795 FSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSKLPADRPSFCSIHRILQRMC 859

  Fly  1319 LRLDNS 1324
            .|.:.:
  Rat   860 ERAEGT 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 17/118 (14%)
TyrKc 1063..1311 CDD:197581 96/277 (35%)
PTKc_Fes_like 1067..1315 CDD:270637 96/277 (35%)
MuskNP_112323.2 IgI_1_MuSK 28..117 CDD:409562 15/94 (16%)
Ig strand B 45..49 CDD:409562 0/3 (0%)
Ig strand C 58..62 CDD:409562 0/3 (0%)
Ig strand E 82..86 CDD:409562 0/3 (0%)
Ig strand F 96..101 CDD:409562 0/4 (0%)
Ig strand G 110..113 CDD:409562 2/2 (100%)
IgI_2_MuSK 122..209 CDD:409560 16/95 (17%)
Ig strand B 138..142 CDD:409560 0/3 (0%)
Ig strand C 151..155 CDD:409560 2/3 (67%)
Ig strand E 173..177 CDD:409560 1/3 (33%)
Ig strand F 187..192 CDD:409560 0/4 (0%)
Ig strand G 201..204 CDD:409560 0/2 (0%)
Ig_3 218..286 CDD:404760 16/71 (23%)
Ig strand A' 222..225 CDD:409353 0/2 (0%)
Ig strand B 229..236 CDD:409353 0/6 (0%)
Ig strand C 242..247 CDD:409353 1/4 (25%)
Ig strand C' 250..252 CDD:409353 1/5 (20%)
Ig strand D 258..262 CDD:409353 0/3 (0%)
Ig strand E 268..272 CDD:409353 1/3 (33%)
Ig strand F 278..286 CDD:409353 1/7 (14%)
CRD_TK_ROR_related 313..457 CDD:143578 33/171 (19%)
PTKc_Musk 568..857 CDD:133181 98/290 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.