DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Fgr

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_077059.2 Gene:Fgr / 79113 RGDID:621319 Length:517 Species:Rattus norvegicus


Alignment Length:403 Identity:139/403 - (34%)
Similarity:214/403 - (53%) Gaps:43/403 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   948 SLSTNRPLY-------------EEEWFHGVLPREEVVRLLNNDGD----FLVRETIRNEESQIVL 995
            |||:.|..|             .|||:.|.:.|::..|.|.:||:    ||:||:...:.:..:.
  Rat   107 SLSSGRTGYVPSNYVAPVDSIQAEEWYFGKISRKDAERQLLSDGNPQGAFLIRESETTKGAYSLS 171

  Fly   996 SVCWNGH-----KHFIVQTTGEGNFRF-EGPPFASIQELIMH--QYHSELPVTVKSGAILRRP-- 1050
            ...|:.:     ||:.::....|.:.. ....|.|:|:|:.|  :.:..|...:.:..::.:|  
  Rat   172 IRDWDQNRGDHIKHYKIRKLDMGGYYITTRAQFESVQDLVRHYMEVNDGLCYLLTAPCMVMKPQT 236

  Fly  1051 --VCRERWELSNDDVVLLERIGRGNFGDVYKAKLK-STKLDVAVKTCRMTLPDEQKRK-FLQEGR 1111
              :.::.||:..:.:.|..|:|.|.||||:..... |||  |||||.:   |.....| ||:|.:
  Rat   237 LGLAKDAWEIDRNSIALDRRLGTGCFGDVWLGTWNCSTK--VAVKTLK---PGTMSPKAFLEEAQ 296

  Fly  1112 ILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLR-KNSNGLTTRQQMGMCRDAAAGMRY 1175
            |:|...|..:|:|..: |.::||.||.|.:..||||.:|: :..:.|.....:.|....|.||.|
  Rat   297 IMKLLRHDKLVQLYAV-VSEEPIYIVTEFMCYGSLLDFLKDRKGHNLMLPNLVDMAAQVAEGMAY 360

  Fly  1176 LESKNCIHRDLAARNCLVDLEHSV-KISDFGMSR--EEEEYIVSDGMKQIPVKWTAPEALNFGKY 1237
            :|..|.|||||.|.|.||. ||.: ||:|||::|  .::||....|.| .|:|||||||..||::
  Rat   361 MERMNYIHRDLRAANILVG-EHLICKIADFGLARLIVDDEYNPQQGTK-FPIKWTAPEAALFGRF 423

  Fly  1238 TSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAE 1302
            |...||||:|||:.|:.:||..||.||.|....|:::.||.||.|...|..:|.:|.|.|..|.|
  Rat   424 TVKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVEHGYHMPCPPGCPVSLYEVMEQTWRLDPE 488

  Fly  1303 SRPHFDEIYNVVD 1315
            .||.|:.:.:.::
  Rat   489 ERPTFEYLQSFLE 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 25/110 (23%)
TyrKc 1063..1311 CDD:197581 108/253 (43%)
PTKc_Fes_like 1067..1315 CDD:270637 107/253 (42%)
FgrNP_077059.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..46
SH3 68..125 CDD:418401 5/17 (29%)
SH2_Src_Fgr 128..228 CDD:198230 23/99 (23%)
PKc_like 255..502 CDD:419665 107/255 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.