DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and ZAP70

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_016860356.1 Gene:ZAP70 / 7535 HGNCID:12858 Length:742 Species:Homo sapiens


Alignment Length:558 Identity:141/558 - (25%)
Similarity:217/558 - (38%) Gaps:155/558 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   839 PC---KQCTKRRRIHPSKSVFDFAKEFEVE-------QPAGSAADEQFCNCPPAGQKPVKPSVQI 893
            ||   |.|.:...:.|...|||..::..|.       :..|.|.::...:..|    .|:..:..
Human   218 PCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAP----QVEKLIAT 278

  Fly   894 SGHKDHPFESSSGELDENSDRDIDNDEEEEDSASDDVLSMKDHCYCVPSLAASISLSTNRPLYEE 958
            :.|:..|                                                          
Human   279 TAHERMP---------------------------------------------------------- 285

  Fly   959 EWFHGVLPREEVVRLL----NNDGDFLVRETIRNEESQIVLSVCWNGH-KHFIVQTTGEGNFRF- 1017
             |:|..|.|||..|.|    ..||.||:|.  |.|:....||:.:... .|:::.....|.:.. 
Human   286 -WYHSSLTREEAERKLYSGAQTDGKFLLRP--RKEQGTYALSLIYGKTVYHYLISQDKAGKYCIP 347

  Fly  1018 EGPPFASIQELI----------MHQYHSELPVTVKSGA-------------ILRRPVCR------ 1053
            ||..|.::.:|:          ::......|.:..|.|             .|..|..|      
Human   348 EGTKFDTLWQLVEYLKLKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNS 412

  Fly  1054 --------------------------------------ERWELSNDDVVLLE-RIGRGNFGDVYK 1079
                                                  ::..|..|::::.: .:|.||||.|.:
Human   413 DGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQ 477

  Fly  1080 A--KLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVL 1142
            .  :::..::|||:|..:.........:.::|.:|:.|.|:|.||:|||:| |.:.:|:|||:..
Human   478 GVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVC-QAEALMLVMEMAG 541

  Fly  1143 GGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMS 1207
            ||.|..:|......:.......:....:.||:|||.||.:||||||||.|:...|..||||||:|
Human   542 GGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLS 606

  Fly  1208 R---EEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRA 1269
            :   .::.|..:....:.|:||.|||.:||.|::|..||||||:.|||..|.|..||..|.....
Human   607 KALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEV 671

  Fly  1270 RERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHF 1307
            ...|:.|.||..|...|.|:|.||..||....|.||.|
Human   672 MAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDF 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 23/101 (23%)
TyrKc 1063..1311 CDD:197581 95/251 (38%)
PTKc_Fes_like 1067..1315 CDD:270637 95/247 (38%)
ZAP70XP_016860356.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.