DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and YES1

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_005424.1 Gene:YES1 / 7525 HGNCID:12841 Length:543 Species:Homo sapiens


Alignment Length:383 Identity:135/383 - (35%)
Similarity:206/383 - (53%) Gaps:36/383 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   958 EEWFHGVLPREEVVRLLNNDGD----FLVRETIRNEESQIVLSVCW-----NGHKHFIVQTTGEG 1013
            |||:.|.:.|::..|||.|.|:    |||||:...:.:..:....|     :..||:.::....|
Human   156 EEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNG 220

  Fly  1014 NFRF-EGPPFASIQELIMH-QYHSE--------LPVTVKSGAILRRPVCRERWELSNDDVVLLER 1068
            .:.. ....|.::|:|:.| ..|::        :..|||...   :.:.::.||:..:.:.|..:
Human   221 GYYITTRAQFDTLQKLVKHYTEHADGLCHKLTT
VCPTVKPQT---QGLAKDAWEIPRESLRLEVK 282

  Fly  1069 IGRGNFGDVYKAKLKSTKLDVAVKTCR--MTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQK 1131
            :|:|.||:|:......| ..||:||.:  ..:|:    .||||.:|:|:..|..:|.|..: |.:
Human   283 LGQGCFGEVWMGTWNGT-TKVAIKTLKPGTMMPE----AFLQEAQIMKKLRHDKLVPLYAV-VSE 341

  Fly  1132 QPIMIVMELVLGGSLLTYLRKNSNG--LTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVD 1194
            :||.||.|.:..||||.:| |..:|  |...|.:.|....|.||.|:|..|.|||||.|.|.||.
Human   342 EPIYIVTEFMSKGSLLDFL-KEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVG 405

  Fly  1195 LEHSVKISDFGMSR--EEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKG 1257
            .....||:|||::|  |:.||....|.| .|:|||||||..:|::|...||||:|||..|:.:||
Human   406 ENLVCKIADFGLARLIEDNEYTARQGAK-FPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKG 469

  Fly  1258 DTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVD 1315
            ..||.||.|....|:::.|||||.|:..||.::.||..||..|.:.||.|:.|.:.::
Human   470 RVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLE 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 24/99 (24%)
TyrKc 1063..1311 CDD:197581 105/253 (42%)
PTKc_Fes_like 1067..1315 CDD:270637 105/253 (42%)
YES1NP_005424.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
SH3_Yes 94..151 CDD:212940
SH2_Src_family 154..253 CDD:199827 24/96 (25%)
PTKc_Yes 264..542 CDD:270654 108/272 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.