DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and TXK

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_024309968.1 Gene:TXK / 7294 HGNCID:12434 Length:530 Species:Homo sapiens


Alignment Length:408 Identity:141/408 - (34%)
Similarity:212/408 - (51%) Gaps:52/408 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   940 VPSLAASISLSTNRPLYEEEWFHGVLPREEVVRLL---NNDGDFLVRE-------TI-------R 987
            :||...:.:..||..:|  ||:|..:.|.:...||   :.:|.|:||:       ||       |
Human   135 IPSNYVTENKITNLEIY--EWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARR 197

  Fly   988 NEESQIVLSVCWNGHKHFIVQTTGEGN-FRFEGPPFASIQELIMHQYHSELPVTVKSGAILRRPV 1051
            :.|:.|         ||:.::....|. :..|...|.||.|||.:..|:...:..:    ||.||
Human   198 STEAAI---------KHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMTR----LRYPV 249

  Fly  1052 -----C--------RERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQK 1103
                 |        .|:||:...::..::.||.|.||.|:..:.:| .:.||:|........|: 
Human   250 GLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRS-HIQVAIKAINEGSMSEE- 312

  Fly  1104 RKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRD 1168
             .|::|.:::.:..|..:|:|.|:|:|::|:.||.|.:..|.||.|||:|...|.....:.:|:|
Human   313 -DFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKGKLRKEMLLSVCQD 376

  Fly  1169 AAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSRE--EEEYIVSDGMKQIPVKWTAPEA 1231
            ...||.|||....||||||||||||.....||||||||:|.  ::||:.|.|.| .|:||:.||.
Human   377 ICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEYVSSFGAK-FPIKWSPPEV 440

  Fly  1232 LNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQC 1296
            ..|.||:|..||||:|:||||:|::|..|:...:|.:..|.|..|:|:..|...|..:|.:|..|
Human   441 FLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISEGFRLYRPHLAPMSIYEVMYSC 505

  Fly  1297 WAADAESRPHFDEIYNVV 1314
            |....|.||.|.|:...|
Human   506 WHEKPEGRPTFAELLRAV 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 27/103 (26%)
TyrKc 1063..1311 CDD:197581 101/249 (41%)
PTKc_Fes_like 1067..1315 CDD:270637 102/250 (41%)
TXKXP_024309968.1 SH3_TXK 88..142 CDD:212840 2/6 (33%)
SH2_Tec_Txk 146..251 CDD:198261 33/119 (28%)
PTKc_Tec_like 269..524 CDD:173637 102/259 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.