DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and SRC

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_016883513.1 Gene:SRC / 6714 HGNCID:11283 Length:542 Species:Homo sapiens


Alignment Length:550 Identity:171/550 - (31%)
Similarity:254/550 - (46%) Gaps:112/550 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   836 RSKPCKQCTKRRRIHPSKSVFDFAKEFEVEQPAGSAADEQFCNCPPAGQKPVKPSVQISGHKD-- 898
            :|||.....:||.:.|:::|          ..||..|.       ||.|.|.||: ...||:.  
Human     5 KSKPKDASQRRRSLEPAENV----------HGAGGGAF-------PASQTPSKPA-SADGHRGPS 51

  Fly   899 --------HP-----FESS--------SGEL-------------DENSDRDID----------ND 919
                    .|     |.||        :|.|             :..::.|:.          |:
Human    52 AAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNN 116

  Fly   920 EEEEDSASDD-----VLSMKDHCYCVPS--LAASISLSTNRPLYEEEWFHGVLPREEVVRLL--- 974
            ..:.|....|     .||.....| :||  :|.|.|:..      |||:.|.:.|.|..|||   
Human   117 TRKVDVREGDWWLAHSLSTGQTGY-IPSNYVAPSDSIQA------EEWYFGKITRRESERLLLNA 174

  Fly   975 -NNDGDFLVRETIRNEESQIVLSVCWNGH------KHFIVQTTGEGNFRFEG-PPFASIQELIMH 1031
             |..|.|||||: ...:....|||....:      ||:.::....|.|.... ..|.|:|:|:  
Human   175 ENPRGTFLVRES-ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLV-- 236

  Fly  1032 QYHSE--------LPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLD 1088
            .|:|:        |.....:.....:.:.::.||:..:.:.|..::|:|.||:|:......| ..
Human   237 AYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGT-TR 300

  Fly  1089 VAVKTCRM-TLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRK 1152
            ||:||.:. |:..|   .||||.:::|:..|..:|:|..: |.::||.||.|.:..||||.:| |
Human   301 VAIKTLKPGTMSPE---AFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMSKGSLLDFL-K 360

  Fly  1153 NSNG--LTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSR--EEEEY 1213
            ...|  |...|.:.|....|:||.|:|..|.:||||.|.|.||......|::|||::|  |:.||
Human   361 GETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEY 425

  Fly  1214 IVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYR 1278
            ....|.| .|:|||||||..:|::|...||||:|||:.|:.:||..||.||.|....::::.|||
Human   426 TARQGAK-FPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYR 489

  Fly  1279 MPTPKSTPEEMYRLMLQCWAADAESRPHFD 1308
            ||.|...||.::.||.|||..:.|.||.|:
Human   490 MPCPPECPESLHDLMCQCWRKEPEERPTFE 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 30/104 (29%)
TyrKc 1063..1311 CDD:197581 103/250 (41%)
PTKc_Fes_like 1067..1315 CDD:270637 102/246 (41%)
SRCXP_016883513.1 SH3_Src 88..149 CDD:212941 10/61 (16%)
SH2_Src_Src 153..253 CDD:198228 30/108 (28%)
PTKc_Src 266..542 CDD:270656 105/260 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.