DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Limk1

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_113915.2 Gene:Limk1 / 65172 RGDID:62055 Length:647 Species:Rattus norvegicus


Alignment Length:295 Identity:85/295 - (28%)
Similarity:143/295 - (48%) Gaps:30/295 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1049 RPVCRERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRIL 1113
            |.|||........|::..|.:|:|.||...|...:.|. :|.|....:...:|.:|.||:|.:::
  Rat   325 RVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETG-EVMVMKELIRFDEETQRTFLKEVKVM 388

  Fly  1114 KQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLES 1178
            :..:|||::|.||:..:.:.:..:.|.:.||:|...::...:.....|::...:|.|:||.||.|
  Rat   389 RCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHS 453

  Fly  1179 KNCIHRDLAARNCLVDLEHSVKISDFGMSR------EEEEYIVS----DGMKQIPV----KWTAP 1229
            .|.|||||.:.||||....:|.::|||::|      .:.|.:.|    |..|:..|    .|.||
  Rat   454 MNIIHRDLNSHNCLVRENRNVVVADFGLARLMIDEKGQSEDLRSLKKPDRKKRYTVVGNPYWMAP 518

  Fly  1230 EALNFGKYTSLCDVWSYGILMWEIFSK--GDTPYSGMTNSRARERIDTGYRMP------TPKSTP 1286
            |.:|...|....||:|:||::.||..:  .|..|...|       :|.|..:.      .|.:.|
  Rat   519 EMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRT-------MDFGLNVRGFLDRYCPPNCP 576

  Fly  1287 EEMYRLMLQCWAADAESRPHFDEIYNVVDALILRL 1321
            ...:.:.::|...|.|.||.|.::...::.|.:.|
  Rat   577 PSFFPITVRCCDLDPEKRPSFVKLEQWLETLRMHL 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 78/269 (29%)
PTKc_Fes_like 1067..1315 CDD:270637 78/269 (29%)
Limk1NP_113915.2 LIM1_LIMK1 5..77 CDD:188846
LIM2_LIMK1 84..138 CDD:188848
PDZ 165..255 CDD:278991
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..316
TyrKc 342..604 CDD:197581 78/269 (29%)
STKc_LIMK1 345..611 CDD:271123 78/273 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.